(data stored in SCRATCH zone)

EMBL: CP002399.PE122

CP002399.PE122       Location/Qualifiers
FT   CDS_pept        120872..121162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05676"
FT                   /inference="similar to AA sequence:KEGG:Sare_0087"
FT                   /protein_id="ADU05676.1"
FT                   /translation="MGIGASIFLIALGAIFAFAIDADLGWLNLNVVGWVLMLAGVAGLL
FT                   TTLYFWNSRRRVVAAPVREQVVAEPVVPVRDDRVVREEYREVRRPGSGYPA"
     atgggcatcg gtgccagcat cttcctcatc gcgctcggcg cgatcttcgc gttcgccatc        60
     gacgccgatc tgggatggct gaacctcaac gtggtgggct gggtgctcat gctcgccggc       120
     gtcgccggcc tgctcaccac gctctacttc tggaacagcc gccgccgggt cgtggccgcc       180
     ccggtccgcg agcaggtggt cgccgagccg gtggtgccgg tgcgcgacga ccgcgtggtg       240
     cgcgaggagt accgcgaggt gcgccgcccg ggctcgggct acccggcctg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page