(data stored in SCRATCH zone)

EMBL: CP002399.PE135

CP002399.PE135       Location/Qualifiers
FT   CDS_pept        complement(137374..139077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0136"
FT                   /product="putative ABC transporter"
FT                   /note="KEGG: mkm:Mkms_1571 putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05689"
FT                   /inference="similar to AA sequence:KEGG:Mkms_1571"
FT                   /protein_id="ADU05689.1"
FT                   /translation="MSASKDGTVGNIVGRMREAMRGEQRVDPDTLIERLTAIQRFLGAV
FT                   DGHVPDAQLVAAHTVVERAGDRLALSGRHTVVALAGATGSGKSSLFNSLARLDLSPVGV
FT                   RRPTTGVAHACVWGPLDGAVRLLDWVGVLPRHRFVRESPLDADDESNLHGLVLLDLPDF
FT                   DSVQHGHRLEVDRLLGLVDLVVWVVDPQKYADRVIHTSYLREFHRHKDVTVVVLNQADR
FT                   LHPTELPKVLDDLRRLLDADGLGGVPLLPTVAVDPNGLEGLRTELERTVAERQAALRRL
FT                   SGDVDAVVADLEPLVGPEPPRTRPGDASAQELTRALAGAAGVPTVAAAVEGAYRHRAVS
FT                   NTGWPLLRSWRKLRPDPLRRLHLPGRDPDAPAESLVAATSVPDPTAAQRSALTLAIRAV
FT                   AERSGSGLPAPWPTAVTAAARARQADLPGALDHAVAATDLGMDRRPGWWRVVGVIQWVV
FT                   TLAALAGLAWLVLGYALRLLGLPPLEHPTLGVVPWPTVLLLGGLLAGLLVATVTRPVVG
FT                   WAARRARRRAEERLLTSVGSVGEKYVLDPVWAVLARYGTARDALREAGRR"
     gtgagcgcga gcaaggacgg caccgtgggc aacatcgtgg gacggatgcg cgaggcgatg        60
     cggggcgagc agcgggtcga cccggacacc ctgatcgaac ggctgacagc gatccagcgg       120
     ttcctcggcg cggtggacgg ccacgtgccc gacgcccagc tcgtcgccgc gcacacggtg       180
     gtcgagcgtg ccggtgaccg gctggcgctc tccggccgcc acacggtggt cgcgctcgcc       240
     ggcgcgaccg gcagcggcaa gtcgagcctg ttcaactcgc tggcgcggct cgacctgtcg       300
     ccggtgggcg tacgccggcc gaccaccggt gtggcgcacg cctgcgtgtg gggcccgctc       360
     gacggcgcgg tccggctgct cgactgggtc ggggtgctgc cccggcaccg gttcgtccgg       420
     gagagcccgc tggacgccga cgacgagtcg aacctgcatg gcctcgtcct gctcgacctg       480
     cccgacttcg actcggtgca gcacggccac cggctggagg tcgaccgcct gctcggcctc       540
     gtcgacctcg tggtctgggt ggtcgacccg cagaagtacg ccgaccgcgt gatccacacc       600
     agctatctgc gcgagttcca caggcacaag gacgtcacgg tcgtggtgct caaccaggcc       660
     gaccggctgc acccgaccga gctgccgaag gtcctcgacg acctgcgccg gctgctcgac       720
     gccgacgggc tcggcggggt gccgctgctg cccaccgtcg cggtggaccc gaacgggctg       780
     gaggggctgc ggaccgagct ggagcgtacg gtcgccgaac ggcaggccgc cttgcgccgg       840
     ctatccggcg acgtggacgc cgtggtggcc gatctcgaac cgctcgtggg gccggagccg       900
     ccgcgcaccc ggcccggtga cgcctcggcg caggagctga cccgggcact ggccggggcg       960
     gccggggtgc cgaccgtggc ggcggcggtc gagggcgcgt accggcatcg ggcggtgagc      1020
     aacaccggct ggccgctgct gcggagctgg cgcaagctgc ggccggatcc gctgcgccgg      1080
     ctgcacctgc ccgggcggga tccggacgcg cccgcggaga gcctggtcgc ggcgacctcc      1140
     gtacccgatc cgacagccgc gcagcgctcg gcgctgacgc tggcgatccg cgcggtggcc      1200
     gagcggtccg gtagcggtct gccggcgccg tggccgaccg cggtgaccgc cgcggcccgg      1260
     gcccggcagg ccgacctgcc gggcgcgctc gaccacgcgg tcgccgcgac cgacctgggc      1320
     atggaccggc ggcccggctg gtggcgggtg gtgggcgtga tccagtgggt ggtcaccctt      1380
     gccgcgctgg ccggcctggc ctggctggtc ctggggtacg cgctgcgcct gctcggcctg      1440
     ccgccgctcg aacacccgac gctcggtgtg gtgccctggc ccacggtcct gctgctcggc      1500
     ggcctgctgg ccgggctgct cgtcgcgacg gtcacccggc cggtggtggg gtgggccgcc      1560
     cggcgggccc ggcggcgggc ggaggagcgc ctgctcacct cggtgggcag cgtcggggag      1620
     aagtacgtgc tggacccggt ctgggcggtg ctggcacgct acggcacggc ccgggacgca      1680
     ctgcgcgagg cgggacggcg ctga                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page