(data stored in SCRATCH zone)

EMBL: CP002399.PE136

CP002399.PE136       Location/Qualifiers
FT   CDS_pept        complement(139133..140950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0137"
FT                   /product="putative ABC transporter"
FT                   /note="KEGG: gob:Gobs_0079 putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05690"
FT                   /inference="similar to AA sequence:KEGG:Gobs_0079"
FT                   /protein_id="ADU05690.1"
FT                   /translation="MTTHGDSATRAGAPAVAARTGATTGDDQPAHAADGLPAALTGLRA
FT                   AISAARFPLTLPSAEPARHAATSLTDQLDDYLLPRLARLDAPLLVVVGGSTGAGKSTLV
FT                   NSLVQARVSAAGVLRPTTRSPVLVCSPTDAAWFRQGELLPGLTRTTEPSEQPGTLHLVT
FT                   APALPPGLAFLDAPDIDSVVDANRALAGQLLAAADLWLFVTTAARYADAVPWELLRSAR
FT                   ARGTAVAMVLDRVPPEAADEVATHLSEMLAEQELGASPLFVLPETWVDGQGLLPDRITA
FT                   PLSDWFARLAADADARATVVRQTLDGALAALHPVVEALAEAADEQVTAADALDERVQAA
FT                   YRSAERSVDQGLKDGRLLRGEVLARWQEFIGTGDFFRGLEARIGRLRDRVVAAVTGRPA
FT                   PASELRTAIESQLVTLLRGVAAEAAENAYTGWKAHPAGAALLEPDLAHPSADLPQRAEQ
FT                   LVRDWQRGVLELVRVEGGDRRFVARTAAYAVNATGLAVMIGVFASTAFIPTGLEVAAGT
FT                   GTAVAGQTVLQAIFGDQAVRNLARKARVDLLDRVGKLLAEEAARYLSRTEAERPAANAG
FT                   AALRWAAVEVERARHRSGLFPGPEQDGRP"
     gtgacgacgc atggcgattc cgccacccgt gccggcgcgc ccgccgtcgc agcccgcacc        60
     ggagccacca cgggcgacga ccagcctgct cacgccgccg acggcctgcc cgccgcgctc       120
     accggcctgc gcgcggcgat cagtgcggcc cgcttcccgc tgaccctgcc ctcggccgag       180
     ccggcccggc acgccgcaac gagcctcacc gaccagctcg acgactacct gctgccccgg       240
     ctggcccggc tcgacgcccc gctcctggtg gtcgtcggcg gttccaccgg cgccggcaag       300
     tcgacgctcg tcaacagcct ggtccaggcg cgggtcagcg cggcgggcgt gctccgcccc       360
     accacccgct ccccggtgct ggtgtgcagc ccgaccgacg cggcctggtt ccggcagggt       420
     gagctgctgc ccggtctgac ccggaccacc gagcccagcg agcagccggg caccctgcac       480
     ctggtcaccg cgccggcgct gccgcccggc ctggccttcc tcgacgcgcc cgacatcgac       540
     tcggtggtcg acgccaaccg ggcgctcgcc ggtcagctgc tcgccgccgc cgacctctgg       600
     ctgttcgtca ccaccgccgc ccggtacgcc gacgccgtcc cctgggaact gctccgcagc       660
     gcccgcgccc ggggcaccgc cgtggcgatg gtgctcgacc gggtgccccc ggaggccgcc       720
     gacgaggtcg ccacccacct gtccgagatg ctcgccgagc aggagctggg cgcctcgccg       780
     ctgttcgtgc tcccggagac ctgggtggac gggcaggggc tgctgccgga ccggatcacc       840
     gcgccgctga gcgactggtt cgcccggctc gccgccgacg ccgacgcccg cgccaccgtg       900
     gtccggcaga cgctcgacgg cgcgctggcc gcgctgcacc cggtggtcga ggcgctggcc       960
     gaggccgccg acgagcaggt caccgccgcc gacgcgctgg acgagcgggt ccaggccgcg      1020
     taccggagcg cggagcggag cgtcgaccag gggctcaagg acggccggct gctgcgcggc      1080
     gaggtactgg cccggtggca ggagttcatc ggcaccggcg acttcttccg tgggctggag      1140
     gcccgcatcg ggcggctgcg cgaccgggtg gtcgcggcgg tcaccgggcg gcccgctccc      1200
     gcctcggaac tgcgtaccgc gatcgagtcc cagctcgtca cgctgctgcg cggggtggcc      1260
     gccgaggcgg cggagaacgc gtacaccggc tggaaggcgc acccggcggg cgcggcgctg      1320
     ctggagccgg acctggccca cccctcggcc gacctgccgc agcgggccga gcagctggtc      1380
     cgcgactggc agcgcggcgt gctggagctg gtccgggtcg agggcggcga ccggcggttc      1440
     gtggcccgca cggccgcgta cgcggtgaac gccaccggcc tcgcggtcat gatcggcgtg      1500
     ttcgcctcca ccgcgttcat ccccaccggg ctggaggtcg ccgcaggcac cggcacggcg      1560
     gtggccgggc agaccgtgct ccaggcgatc ttcggcgacc aggcggtccg caacctggcc      1620
     cgcaaggccc gcgtcgacct gctcgaccgg gtcggcaagc tgctggccga ggaggccgcg      1680
     cgctacctga gccgcaccga ggccgagcgc ccggccgcca acgccggtgc ggcgctgcgc      1740
     tgggccgccg tagaggtcga gcgggcccgg caccgcagcg gcctgttccc gggccccgag      1800
     caggacggtc gcccgtga                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page