(data stored in SCRATCH zone)

EMBL: CP002399.PE14

CP002399.PE14        Location/Qualifiers
FT   CDS_pept        complement(16287..16853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0014"
FT                   /product="ATP-binding protein"
FT                   /note="KEGG: ccs:CCNA_00911 ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05568"
FT                   /inference="similar to AA sequence:KEGG:CCNA_00911"
FT                   /protein_id="ADU05568.1"
FT                   /translation="MPGFILTGAPGSGKTAILRHLEVDGHPVVEEAATDVIALHQALGR
FT                   PEPWREPDFAERVLALQRRRRRRAEAHAGEIVFHDRSPVCTLALCRHLGSTPPSALLDE
FT                   VERLTTERRHYERTVFFVRNQGFVEATAARRISFEESLVFERVHELTYRDAGFDLVEVP
FT                   AGPLATRVAAIKQAVDRLRAARVRT"
     atgcccggat tcatcctcac cggcgctccc ggctccggta agaccgcgat cctgcgccac        60
     ctggaggtcg acggccatcc cgtcgtggag gaggcggcga ccgacgtgat cgcgctgcac       120
     caggcgctcg gccggcccga accgtggcgg gagccggact tcgccgagcg ggtgctggct       180
     cttcagcgga ggcgtcggcg ccgagccgaa gcgcacgccg gggagatcgt cttccacgac       240
     cgctcacccg tctgcacgct cgcgctgtgc cgccacctgg ggtcgacgcc gccgtccgcc       300
     ctgctggacg aggtcgagcg cctgacgacg gaacgccgcc actacgagcg gaccgtcttc       360
     ttcgtacgga atcagggctt cgtcgaggcg accgccgccc gccggatcag cttcgaggag       420
     tcgctcgtct tcgagcgcgt ccacgaactg acgtaccgcg acgcgggatt cgacctcgtc       480
     gaggtgcccg cgggaccgct cgcgacgcgg gtggccgcga taaagcaggc ggtcgatcgt       540
     ctgcgcgccg ctagggtgcg gacatga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page