(data stored in SCRATCH zone)

EMBL: CP002399.PE147

CP002399.PE147       Location/Qualifiers
FT   CDS_pept        149289..149555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05701"
FT                   /inference="similar to AA sequence:KEGG:Sare_4346"
FT                   /protein_id="ADU05701.1"
FT                   /translation="MTGRYVIHLPVRAADLARAKMLGRTAGRSLAFLAVVELGGITVST
FT                   EDDQSVRHWVFCDRKLDGGRRCVLRADHETPCLARLPGRTGGR"
     gtgaccgggc ggtacgtgat ccatctgccg gtgcgcgcgg cggacctggc ccgggcgaag        60
     atgctcggtc gcacggccgg ccggtcgttg gcgttcctcg cggtggtgga gctgggcggg       120
     atcaccgtgt cgacggagga cgaccagtcc gtacgccatt gggtgttctg cgaccgcaag       180
     ctggacggcg gccggcgttg cgtgctgcgc gccgaccacg agactccctg cctcgcgcgt       240
     ctccccggcc ggaccggagg acggtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page