(data stored in SCRATCH zone)

EMBL: CP002399.PE149

CP002399.PE149       Location/Qualifiers
FT   CDS_pept        152449..152826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO7682 non-ribosomal peptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05703"
FT                   /inference="similar to AA sequence:KEGG:SCO7682"
FT                   /protein_id="ADU05703.1"
FT                   /translation="MSGSWERELDLAVRELDGADTLAFGGVGLAGQVLPATEAYRRLEQ
FT                   GLREHPEAARKRVDRLLRKGSPAGRAYAATLLEAVDPAAGRAAWTRLRDDDGEFTTFSG
FT                   CLMGRATLGEYAADRLAGTGQ"
     atgagcggga gctgggaacg ggaactggac ttggcggtgc gggaactcga cggcgcggac        60
     accctcgcct tcggcggggt ggggctggcg gggcaggtgc tgcccgcgac cgaggcgtac       120
     cgacggctgg aacaggggtt gcgggagcac ccggaggcgg cccgcaagcg ggtcgacagg       180
     ttgctccgca agggctcccc ggccgggcgg gcgtacgcgg cgacgctgct ggaggcggtc       240
     gacccggccg ccgggcgggc ggcgtggacg cggctgcgcg acgacgacgg cgagttcacc       300
     acgttctccg gctgcctgat gggccgggcc acgctgggcg agtacgcggc cgaccggctc       360
     gccggcaccg gccagtag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page