(data stored in SCRATCH zone)

EMBL: CP002399.PE182

CP002399.PE182       Location/Qualifiers
FT   CDS_pept        complement(185268..185891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0183"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   stp:Strop_0139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05736"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADU05736.1"
FT                   /translation="MGDVLDLLHHTVTSPWVYLVIIAVTAVDAFFPAVPGETVVITAGV
FT                   FAAGGEPNLVLVIVTAAFGALAGDHISYAIGRGGGAHRLARFPADSRRRASSEWARRAV
FT                   DRRGGMILTTARYVPGGRTAVTLTMGAVRYPARTFLLYDGLACTTWGVYCGLLGYFGGL
FT                   AFEHNPLSGLLAGVAISLAVTGLFEAVRWGRRRAHRRAAARRDC"
     atgggggacg tgctcgacct gctgcaccac acggtgacgt cgccgtgggt gtacctggtg        60
     atcatcgcgg tcaccgccgt cgacgcgttc ttcccggcgg tgccgggcga gacagtggtg       120
     atcaccgccg gggtcttcgc ggccggcggc gagccgaacc tggtgctggt gatcgtgacc       180
     gccgcgttcg gcgcgctcgc cggcgaccac atctcgtacg cgatcgggcg cggcggcggc       240
     gcgcaccggc tggcccgctt cccggcggac agcaggcggc gggccagctc ggagtgggcc       300
     cgccgggcgg tcgacagacg cggcgggatg atcctgacca ccgcccggta cgtccccggc       360
     ggccggaccg ccgtcacgct gaccatgggc gcggtccgct atcccgcgcg cacgttcctg       420
     ctgtacgacg gcctggcgtg caccacctgg ggggtctact gcgggctgct cggctacttc       480
     ggcggcctgg cgttcgagca caacccgctg tccgggctgc tcgccggcgt ggccatctcg       540
     ctggccgtca ccggcctgtt cgaggccgtc cgctggggcc ggcggcgggc gcaccggcgg       600
     gctgccgccc ggcgcgactg ttaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page