(data stored in SCRATCH zone)

EMBL: CP002399.PE185

CP002399.PE185       Location/Qualifiers
FT   CDS_pept        complement(188142..189125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0186"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nda:Ndas_0835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05739"
FT                   /inference="similar to AA sequence:KEGG:Ndas_0835"
FT                   /protein_id="ADU05739.1"
FT                   /translation="MRTEEAIRLVTAARTDADLFGTQEPARRYRELVGALHPDRLGAAD
FT                   PGVRAAAADALVTVTTRWRTPAPTYTGDVATLHERKEGPPVNASGRGGAPSYHLAKVCR
FT                   HPGDNDLMAREARALRRIAERGDAKHLAYVPRLVDSYPARDPSTGVQRQVNELMTVPGL
FT                   RSLDDVRRAYPDGLDPRDAAWMWRRLLVALGLAHRAGVVHGAVLPRHVLIEPDAHGLVL
FT                   VDWCFSAEPGGLVPALVPGHEDWYPPEVAAKRQCGPGTDIALAARCMTWLMGDRAPREL
FT                   RAFADGCQGTALATRPDDAWRLLRELDEVLHRLYGPRTFRPFTLNP"
     gtgaggaccg aggaggcgat ccggctggtc acggccgcgc gcaccgacgc cgacctgttc        60
     ggcacgcagg agccggcccg ccgctaccgc gagctggtcg gcgcgctgca ccccgaccgg       120
     ctgggcgcgg ccgacccggg ggtacgcgcc gccgccgccg acgcgctcgt cacagtcacc       180
     acccggtggc gcactcccgc ccccacgtac acaggcgacg tcgccaccct gcacgaacgg       240
     aaggaagggc cccctgttaa cgcctccggt agaggagggg ccccttctta tcacctggcc       300
     aaggtgtgcc ggcaccccgg cgacaacgac ctgatggccc gcgaggcacg cgcgttgcgg       360
     cggatcgccg agcgcggcga cgccaagcac ctcgcgtacg tgccccggct cgtcgactcc       420
     tacccggcgc gcgacccgtc gaccggcgtg caacggcagg tcaacgagct aatgaccgta       480
     cccggactgc gaagcctgga cgacgtgcgc cgcgcgtacc cggacgggct ggacccgcgc       540
     gacgcggcct ggatgtggcg gcggctgctc gtggcgctcg gcctggccca ccgggccggc       600
     gtcgtgcacg gcgcggtgct gccccggcac gtgctgatcg agccggacgc acacggcctg       660
     gtgctcgtcg actggtgctt ctcggccgag ccgggcgggc tcgtgccggc gctcgtgccc       720
     ggccacgagg actggtatcc gccggaggtc gccgcgaagc ggcagtgcgg gccgggcacc       780
     gacatcgcgc tcgccgcccg ctgcatgacc tggctgatgg gcgaccgcgc gccgcgcgag       840
     ctgcgcgcct tcgccgacgg ctgccagggc accgcgctcg ccacccggcc ggacgacgcc       900
     tggcggctgc tgcgcgaact ggacgaggtg ctgcaccggc tgtacgggcc gcgcaccttc       960
     cgacccttca ccctcaaccc gtag                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page