(data stored in SCRATCH zone)

EMBL: CP002399.PE196

CP002399.PE196       Location/Qualifiers
FT   CDS_pept        200706..203417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0197"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; KEGG: saq:Sare_0159 phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05750"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ADU05750.1"
FT                   /translation="MTTHPDPALREPQGVVPQAGPTDDWALGVDTVPRAADSPEELQPY
FT                   AELGLRDDEYDRIRHILGRRPTQAELAMYSIMWSEHCSYKSSKVHLRQFGEKAPPSDRL
FT                   LAGIGENAGVVRVSDELAVTFKVESHNHPSFVEPYQGAATGVGGIVRDILAMGARPVAV
FT                   MDPLRFGAADHPDTARVLPGVVAGVGGYGNCLGLPNIGGEVVFDPCYQGNPLVNALCLG
FT                   VLPVDRLQKKDATGPGNIVVLMGAKTGRDGIGGVSVLASATFDEGSEQRRPSVQVGDPF
FT                   MEKLLIEACLELYDAELVVGIQDLGGAGLTCALTETAASAGTGMRVWLERVPLREPSME
FT                   PHEILASESQERMLLVVSPDKLDAVLKTAEKWGVWATAIGEVTAPSADGQPGRLVVTWR
FT                   DQLVVDVPPGSLVDDGPVYARPMREPADLILLQADRAETLPRPSTPEALRETVLRMIAS
FT                   PNLADKTWVTEQYDRYVLGNTVLAQPEDSGVIRIDERSGLGVALSVDGNGRYARLDPYH
FT                   GTKLALAEAYRNVAVTGAKPIAVTNCLNFGSPEDPGVMWQFAEAVRGLADGCLELGIPV
FT                   TGGNVSFYNQTGAAAIHPTPVVGVLGVLDDVANRVPMGFVPRPAGDHDQLFLLGETHVE
FT                   LSGSEWAWVTHEHLGGIPPQVDLARERQLAELLAEAARVGHLSSAHDLSDGGLAQSLVE
FT                   SALRRGVGARVVVPEHFAGGSMPFVFLFSESAGRVLVSVPRGHEKAFTALCAERGVPWE
FT                   FIGVTDPASGGLEVHGQFRIGLDELREAHTGTLPRLFGAAEAARVEVEATRTGTTTVLP
FT                   ATAEQPVGVDPAAVDAEPIAKAGRDTPAADAEASAPAAEAEPEASAAASDEAEPAEGTA
FT                   TPAVDGTPAQDESAPADGSDGPAPGEPAPGQR"
     atgaccaccc atccggaccc ggccctgcgc gagccgcagg gcgtggtgcc gcaggccggc        60
     ccgaccgacg actgggcgct gggcgtggac accgttcccc gggccgccga ctcgccggag       120
     gagcttcagc cgtacgccga gctgggcctc cgcgacgacg agtacgaccg gatccggcac       180
     atcctcggcc gccggcccac ccaggccgag ctggccatgt actcgatcat gtggagtgag       240
     cactgctcct acaagtcgag caaggtgcac ctgcgccagt tcggcgagaa ggcgccgccg       300
     agtgaccggc tgctcgccgg catcggggag aacgccggcg tggtccgggt ctccgacgag       360
     ctggcggtga ccttcaaggt cgagtcgcac aaccacccga gcttcgtcga gccgtaccag       420
     ggcgcggcga ccggcgtcgg cggcatcgtc cgcgacatcc tcgccatggg cgcccgcccg       480
     gtcgccgtga tggacccgct gcgcttcggc gcggccgacc acccggacac cgcccgggta       540
     ctgcccggcg tggtcgccgg cgtcggcggc tacggcaact gcctgggcct gcccaacatc       600
     ggcggcgagg tcgtcttcga cccctgctac cagggcaacc cgctggtcaa cgcgctctgc       660
     ctgggcgtgc tgccggtcga ccggctgcag aagaaggacg ccaccggccc cggcaacatc       720
     gtggtgctga tgggcgccaa gaccggccgc gacggcatcg gcggagtgtc cgtgctcgcc       780
     agcgccacct tcgacgaggg cagcgagcag cgccgcccgt ccgtgcaggt gggcgacccc       840
     ttcatggaga agctgctcat cgaggcgtgc ctggagctgt acgacgccga actggtcgtc       900
     ggcatccagg acctcggcgg cgccggcctg acctgcgccc tcaccgagac cgccgcctcc       960
     gccggcaccg gcatgcgggt ctggctggag cgcgtgccgc tgcgcgagcc gtcgatggaa      1020
     ccgcacgaga tcctggccag cgagtcccag gagcggatgc tgctcgtcgt ctcgccggac      1080
     aagctcgacg ccgtgctgaa gaccgccgag aagtggggcg tctgggccac cgccatcggc      1140
     gaggtcaccg cgccgtcggc ggacggccag ccgggccgcc tggtcgtcac ctggcgcgac      1200
     cagctcgtgg tggacgtgcc gccgggctcg ctcgtcgacg acggcccggt gtacgcccgg      1260
     ccgatgcgcg agccggccga cctgatcctg ctccaggccg accgcgccga gacgctgccc      1320
     cggccgagca ccccggaggc gctccgggag accgtgctgc gcatgatcgc gtcgccgaac      1380
     ctggccgaca agacctgggt gaccgagcag tacgacaggt acgtgctcgg caacaccgtg      1440
     ctcgcccagc cggaggactc cggcgtgatc cggatcgacg agcgcagcgg cctgggtgtc      1500
     gcgctctccg tcgacggcaa cggccggtac gcgcgcctcg acccgtacca cgggacgaag      1560
     ctggcgctgg ccgaggcgta ccggaacgtg gcggtgaccg gcgcgaagcc gatcgcggtg      1620
     accaactgcc tgaacttcgg ctcgccggag gacccgggcg tgatgtggca gttcgccgag      1680
     gccgtgcgcg gcctggcgga cggctgcctg gagctgggca tcccggtgac cggcggcaat      1740
     gtcagcttct acaaccagac cggcgccgcc gccatccacc cgaccccggt ggtcggcgtg      1800
     ctcggcgtgc tcgacgacgt cgcaaaccgg gtgccgatgg gcttcgtgcc gcgcccggcc      1860
     ggcgaccacg accagctgtt cctgctgggc gagacgcacg tcgagctgtc cggctcggag      1920
     tgggcctggg tgacgcacga gcacctgggc ggcatcccgc cgcaggtcga cctggcccgc      1980
     gagcggcagc tcgccgaact gctggccgag gcggcccggg tcgggcacct cagctccgcg      2040
     cacgacctgt ccgacggcgg cctggcgcag agcctggtcg agtcggctct gcgccgcggc      2100
     gtgggcgccc gggtcgtggt gccggagcac ttcgccggtg gctcgatgcc gttcgtgttc      2160
     ctgttcagcg agtccgccgg ccgcgtgctg gtgtcggtgc cgcgcggcca cgagaaggcg      2220
     ttcaccgccc tctgcgccga gcgcggcgtg ccgtgggagt tcatcggcgt caccgacccg      2280
     gcctccggcg ggcttgaggt gcacggccag ttccggatcg gcctggacga gctgcgcgag      2340
     gcgcacaccg gtacgctccc gcgcctgttc ggtgccgccg aggcggcccg cgtggaggtg      2400
     gaggcgaccc gtaccggcac gaccactgtg cttccggcca ccgcggagca gccggtcggc      2460
     gtggacccgg ccgctgtcga cgccgagccg atcgccaagg ccggccggga caccccggcg      2520
     gccgacgccg aggcgtccgc acccgccgcc gaggcggagc ccgaggcgtc cgctgcggcg      2580
     tccgacgagg ccgagccggc cgagggtacg gcgacgccgg cagtcgacgg aaccccggcc      2640
     caggacgagt cggcgcccgc cgacgggtcc gacggtccgg ctcccggtga gccggcgccg      2700
     ggtcagcgct ga                                                          2712
//

If you have problems or comments...

PBIL Back to PBIL home page