(data stored in SCRATCH zone)

EMBL: CP002399.PE221

CP002399.PE221       Location/Qualifiers
FT   CDS_pept        complement(224162..225127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0222"
FT                   /product="WD40-like beta Propeller containing protein"
FT                   /note="PFAM: WD40-like beta Propeller containing protein;
FT                   KEGG: sal:Sala_2007 peptidase S9, prolyl oligopeptidase
FT                   active site region"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05775"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ADU05775.1"
FT                   /translation="MRALRTALTPVLVLAVILLSGCGRVSGLLDRVSLFHPVWAADGWV
FT                   YYLREVTSTSGSGVAEVWRQRPDGSAEEPVLKRAPAVSTCEAGLFSFLFAGPGGDLGVA
FT                   LECGWDETELLSYSPADKTFEPLASTRFLAEAALVNRGGGGYVEAPRECGPGGVQLLAD
FT                   GKAYEFGSPVTVGGVTFNLSGGDTDCESTVLARSPAALGERLFFITAPDSLGRLPLPPE
FT                   VSPDDLTWHLTEWAVGSATARFITELPGLADLAVSPDGRSVIAAVASDHVGGVWSVDVR
FT                   TGKKTRIAGGARAYHPSFSPDGKRFVYVEKLERLKFAEAR"
     gtgcgtgcgc tgcgtacggc tctgacgccg gtcctcgtac tggccgtgat cttgctcagc        60
     gggtgtggcc gggtctcggg gctcctggac cgagtctccc tgttccatcc ggtctgggcc       120
     gccgacggct gggtctacta cctgcgggag gtgacctcga cctcgggctc gggagtagcc       180
     gaggtgtggc ggcagcgacc cgatgggagc gccgaggaac ccgttctcaa gcgcgcgcca       240
     gcggtatcca cctgcgaagc gggcttgttc agcttcctgt tcgccggccc cggcggcgac       300
     ctcggggtgg ccctcgaatg cggctgggac gaaaccgagc tgctcagcta ctcgccggcc       360
     gacaagacgt tcgagcctct ggcatcgacg cgtttcctcg ccgaagccgc actcgtgaac       420
     cgtggcggcg ggggatatgt ggaggcgccc cgggagtgcg gtccgggggg agtccagctg       480
     ctcgccgacg ggaaggcgta cgagttcggc tctccggtga cggtgggcgg agtgaccttc       540
     aacctgagcg gcggtgacac ggattgcgag tcgacggtgc tggcgcggtc gcctgcggcg       600
     ctgggtgaac ggctgttctt catcaccgca cccgactccc tcggcaggtt gccgctgccg       660
     cccgaggtga gtccggacga tctcacctgg cacctgacgg agtgggccgt cggatcggcc       720
     acagccaggt tcatcacgga gcttcccggc ctcgccgacc tggcggtgtc gccggacggc       780
     cggtcggtga tcgccgccgt cgcgtcggac cacgtgggcg gggtctggtc ggtcgacgtc       840
     cgcaccggga agaagacgag gatcgccggc ggcgcccgcg cctaccaccc gagcttctcg       900
     ccggacggga agcggttcgt ctacgtcgaa aagctcgaac ggctgaaatt cgccgaggca       960
     cggtag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page