(data stored in SCRATCH zone)

EMBL: CP002399.PE227

CP002399.PE227       Location/Qualifiers
FT   CDS_pept        complement(230282..231436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0228"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: saq:Sare_4930
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05781"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADU05781.1"
FT                   /translation="MANDAVAGNALRVAPAQPGATDDPVRGVLAAFTKDLIKGVDETLA
FT                   AFLAAEVESLTEIDAAMGGFAATARDSVLAGGKRVRPTFAYWGWRGVVGGEEPLCSVLP
FT                   ALSALELLHTFALVHDDVMDASDTRRGLPTAHRAAAARHRAAGHTGDPDRYGEAVAVLI
FT                   GDLCMVWADRLMAHAAVPAERLLDVRRCYDQMRVETVAGQFLDVLGENDSASWTVDRAL
FT                   RVARYKTASYTVQRPLLFGACLAGADADDPLIAAYTRYGLAVGEAFQLRDDLLGVYGDP
FT                   ETTGKPAGDDLRTGKPTALLMLARQLADPAQRRVLERAGSVTSATEVDRLADVVRDTGA
FT                   TARVERMISDRVTEALAALGTAPIDETARTALTGLATAATARRA"
     atggccaacg acgcagttgc gggtaatgcg ctccgcgtcg cgccggctca gcccggggcg        60
     acggacgatc cggtccgcgg cgtactggcc gcgttcacga aagacctgat caaaggggtc       120
     gatgagacgc tcgcggcgtt cctggccgcg gaagtcgaat cgctcaccga gatcgacgca       180
     gcgatgggtg gtttcgcggc cacggcacgc gacagcgtgc tggccggcgg caagcgggtc       240
     cgccccacgt tcgcgtactg gggatggcgg ggtgtggtcg gcggggagga accgctgtgc       300
     tcggtgctcc cggccctgtc cgcgctggag ttgctgcaca cgttcgcgct ggtgcacgac       360
     gacgtgatgg acgcgtccga caccaggcga gggctgccca ccgcgcaccg ggccgccgcc       420
     gcccggcacc gggccgccgg acacaccggc gaccccgacc ggtacggcga agccgtcgcc       480
     gtcctcatcg gtgacctctg catggtctgg gccgaccggc tgatggcgca cgcggcggtc       540
     ccggcggagc ggctgctcga cgtgcgccgc tgctacgacc agatgcgggt ggagacggtc       600
     gccgggcagt tcctggacgt gctcggcgag aacgactcgg cgagctggac cgtcgaccgg       660
     gcgctgcggg tggcccggta caagaccgcc agctacaccg tccagcgtcc gctgctgttc       720
     ggcgcctgcc tggcgggcgc cgacgcggac gacccgctca tcgccgcgta cacccggtac       780
     gggctggccg tcggcgaggc gttccagctc cgcgacgacc tgctgggcgt ctacggcgac       840
     ccggagacca ccggcaagcc ggccggggac gacctgcgta ccggcaagcc gaccgccctg       900
     ctgatgctgg cccggcagct cgccgacccg gcgcagcgcc gggtcctgga gcgggccggc       960
     tcggtcacct cggcaactga ggtggaccgg ctggccgacg tggtccggga caccggggcc      1020
     acggcccggg tggagcggat gatctccgac cgggtgaccg aggcgctcgc cgcgctgggc      1080
     accgcaccga tcgacgagac cgcgcgcacc gcgctgaccg gcctcgccac cgccgccacg      1140
     gcgcggcggg catga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page