(data stored in SCRATCH zone)

EMBL: CP002399.PE236

CP002399.PE236       Location/Qualifiers
FT   CDS_pept        complement(239960..240433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0237"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: stp:Strop_4452 TadE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05790"
FT                   /inference="protein motif:PFAM:PF07811"
FT                   /protein_id="ADU05790.1"
FT                   /translation="MNAGPRRDRGSVSIEVAVLAPAFIGLMVLAGVAGRTAIADEAVES
FT                   AAHDAARAASLARTADDGAEAAEVAAQDQLGWAGLNCTGPPQIDLAGSVAGTTTSFAAA
FT                   YQSAAGVPATVTVTVTCTVSFDDLSAPGLPGVPGGKTVSASFTSPLDTYRSRG"
     atgaacgccg ggccacggcg ggaccggggt tccgtctcga tcgaggtggc ggtgctcgcg        60
     cccgccttca tcgggctgat ggtgctggcc ggggtcgccg ggcggaccgc gatcgcggac       120
     gaggcggtgg agtcggccgc ccacgacgcc gcccgggccg cctcgctcgc ccgcaccgct       180
     gatgacggcg cggaggccgc cgaggtggcg gcccaggacc agctcggctg ggcagggctg       240
     aactgcaccg gcccacccca gatcgatctc gcgggctcgg tggccgggac gacgacgagc       300
     ttcgccgccg cgtaccagag cgccgcaggc gtgccggcga cagtgaccgt cacggtgacc       360
     tgcaccgtct ccttcgacga cctgagcgcg cccggcctgc ccggcgtgcc gggcggcaag       420
     accgtctcgg cgagcttcac ctcgccgctg gacacctacc ggagtcgcgg atga             474
//

If you have problems or comments...

PBIL Back to PBIL home page