(data stored in SCRATCH zone)

EMBL: CP002399.PE261

CP002399.PE261       Location/Qualifiers
FT   CDS_pept        260633..263794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0262"
FT                   /product="AAA ATPase"
FT                   /note="KEGG: mva:Mvan_1183 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05815"
FT                   /inference="similar to AA sequence:KEGG:Mvan_1183"
FT                   /protein_id="ADU05815.1"
FT                   /translation="MNEAERNALAALRFDWAPVPDDVWRPLPFHVEGLHVPVLRDVLAG
FT                   VDEAASNPHGSPLGLVVQGQRGSGKTHLLGVIRQQVQERDGYFFLVGLLDAGSFWDGVL
FT                   AAMLDGLSRPVPGRRETQLKLLLRRLSALVGAPRTARRAVMGDTELTRAALDAFLEGLG
FT                   AFDRHAARTCQETARALALSASEDISHRDIAENYFLSGEEVAAGERAAWGMRRVPRPAQ
FT                   QIVQDLSWLLALTGPSVVAIDQIDTLIAQLAIQSDPALAGAVAMSPEQALMLARMADGL
FT                   MALRQTTRRTLTVLACIPNSWTIIKSTAADTVADRFRETPPLRRIDDADVARAIIEKRF
FT                   TLRYQEAGFVPPYPSWPVSPRAFAGAGAFTPRQLLIEIDKHIRECLADDEVREMTSLGE
FT                   PPIAEPRAPRPAPVTATGEEMDRYDARFAELREAADVTGPLRRTSEDAAMPPLLAAGLT
FT                   AWILERGDAGEAFSVDPPPSTDPPLHARLRLTLDERTEDQVHWCFRAIGDDHHGNAALA
FT                   RLRKASVAAALDTGSGRRKLFLLRNRAWSTSAATSKAVGAFTAAGGQTLGVDEEDLRVL
FT                   SALRVMLAEATMDLQGWLAERRPTRELKFLQHALADVDRWGPDAGPLPEPAEPPPAAAV
FT                   TGPADPSFVVGHGYDDGTPVPLALEALRKHTTIFAGSGSGKTVLIRRIVEECALAGISA
FT                   IVLDPNNDLARLGEGWPEPPAQWRPGDADRARDYLTHTDVVVWTPRRNSGRPLSFQPLP
FT                   DFTGVRDDPDEFGEAVEAAVASLAPRAMLTGRATRAHLGLAVLRKAVEHYGRRGGSRLQ
FT                   GLIDTLADLPDGIIDLDDADKIGLSLAQTLTAAMVNDPLFGGEGTPMDPGVLLTPAPGK
FT                   RARVSVVSLVGLPSDDVRQSFVNQLQMALFAWIKKNPAGDRPLLGLLIMDEAQTFAPSG
FT                   AMTACTQSTLALAAQARKYGLGLIFATQAPKGLHNRIPGNAATQLYGLMNSPIQIEAAR
FT                   EMARAKGGDVPDISRLTVGEFYLAAEGAAPRKIRTPLSLTHHPRSPLTVEEVLDRARGG
FT                   QGRST"
     atgaacgagg cggaacggaa cgcgttggcc gccctgcggt tcgactgggc gccggtgccc        60
     gacgacgtgt ggcggccgtt gcccttccac gtcgagggac tgcacgtccc ggtcctccgg       120
     gacgtgctcg ccggggtgga cgaggccgcg tcgaacccgc acggcagccc gctcggcctg       180
     gtcgttcagg gtcagcgcgg ctccggcaag acccacctgc tgggtgtgat ccgccagcag       240
     gtgcaggagc gtgacggcta cttcttcctg gtcggtctgc tcgacgccgg tagcttctgg       300
     gacggcgtgc tcgccgcgat gctcgacggc ttgtcccggc cggtgcccgg caggcgcgag       360
     acgcagctca aactgctgct gcggcgcctg tccgccctgg tcggggcacc ccggacggcg       420
     cgccgggccg tcatgggcga caccgagctg acccgagcgg cgctcgatgc attcctggaa       480
     gggctgggcg ccttcgacag gcatgccgcc cgcacctgcc aggagacggc tcgcgcgcta       540
     gcgctcagcg cctccgagga catctcccac cgcgacatcg cggagaacta cttcctctcg       600
     ggcgaggagg tggccgccgg ggaacgcgcg gcctggggca tgcgccgcgt tccgcgccct       660
     gcccagcaga tcgtgcagga cctgtcctgg cttctcgccc tcaccggccc gtcggtggtg       720
     gcgatcgacc agatcgacac gctcatcgcc cagttggcga tccagagcga tcccgccctg       780
     gccggtgccg ttgcgatgag cccggagcag gcgctgatgc tggcccggat ggcggacggc       840
     ctgatggcgt tacggcagac gacccggcgc acgctcaccg tcctggcctg cattccgaac       900
     tcgtggacca tcatcaagtc caccgccgcc gacaccgtcg cagaccggtt ccgggagacg       960
     ccgccgctgc gccgcatcga cgacgccgac gtggcccggg cgatcatcga gaagcggttc      1020
     accctccgct accaggaggc ggggttcgtc ccgccgtacc cgtcgtggcc ggtatcaccg      1080
     cgcgccttcg ccggggccgg tgcgttcacc ccgcgtcagc tgctcatcga gatcgacaag      1140
     cacatccgcg aatgcctcgc cgacgacgag gtccgggaga tgacgagcct cggcgagccg      1200
     cccatcgcgg aaccccgggc tccccggccc gccccggtga ccgccaccgg cgaggagatg      1260
     gaccgctacg acgcccggtt cgccgagctg cgggaggccg ccgacgtcac gggcccgctg      1320
     cgccgcacat ccgaggacgc ggcgatgccg ccgctgctcg ccgccgggct caccgcctgg      1380
     atcctggagc ggggcgacgc gggcgaggcg ttcagcgtcg acccgccccc gagcaccgac      1440
     ccgccgctgc acgcccggct gcggctcacg ctcgacgagc gcaccgagga ccaggtgcac      1500
     tggtgtttcc gggcgatcgg cgacgaccac cacggcaacg ccgcgctggc ccggctccgc      1560
     aaggcgtcag tggccgccgc cctcgacaca ggctccggca ggcgcaagct gttcctgctg      1620
     cgcaaccgcg cctggtcgac cagcgcggcc accagcaagg cggtgggggc gttcaccgcg      1680
     gcgggcggcc agacgctcgg cgtcgacgag gaggacctgc gagtcctctc cgcgctgcgg      1740
     gtcatgctcg ccgaggccac catggacctg cagggctggc tggccgagcg ccggccgacc      1800
     cgggagctga agttcctcca gcacgccctg gccgacgtgg accggtgggg ccccgacgcc      1860
     gggccgttgc cggaacccgc cgagcccccg ccagccgctg ccgtcaccgg cccggccgat      1920
     ccctccttcg tcgtcgggca cgggtacgac gacgggacgc ccgtgccgct ggcgttggag      1980
     gcgttgcgca agcacaccac gatcttcgcc gggtccggct ccggtaagac cgtcctcatc      2040
     cgccgcatcg tcgaggagtg cgcgctggcg ggcatctccg ccatcgtgct cgacccgaac      2100
     aacgacctcg cacggctcgg cgagggatgg cccgagccgc ccgcacagtg gcgccccggc      2160
     gacgcggacc gggcccgcga ctacctcacc cacaccgacg tcgtcgtctg gacgccccgc      2220
     cgcaactcgg gtcgcccgct gagcttccag ccgctgcccg acttcaccgg cgtacgcgac      2280
     gacccggacg agttcggcga ggccgtcgag gccgccgtcg cgtccctcgc accacgcgcc      2340
     atgctcaccg ggcgggccac ccgggctcat ctggggctgg ccgtgctgcg caaggcggtc      2400
     gagcactacg gacggcgcgg cggctcccgc ctgcagggcc tcatcgacac gctcgccgac      2460
     ctgccggacg gaatcatcga cctggacgac gccgacaaga tcggcctcag cctggcgcag      2520
     accctgaccg cagccatggt gaacgacccg ctgttcggcg gcgagggcac accgatggac      2580
     cccggcgtgc tcctcacccc cgcccccggc aaacgggccc gcgtctcggt ggtcagcctg      2640
     gtgggtctgc cgtccgacga cgtacggcag agtttcgtca accagctcca gatggccctg      2700
     ttcgcctgga tcaagaagaa cccggccgga gaccggccgc tgctcgggct gctcatcatg      2760
     gacgaggcgc agacgttcgc cccgtccggc gcgatgaccg cgtgtaccca gagcacactg      2820
     gcgctggccg ctcaggcccg caagtacggc ctgggtctga tcttcgccac ccaggcgccg      2880
     aagggcctgc acaaccgcat cccgggcaat gcggcgaccc agctctacgg cctgatgaac      2940
     agcccgatcc agatcgaggc agcccgggag atggcccggg ccaagggcgg cgacgtgccg      3000
     gacatctccc gcctcaccgt gggcgagttc tacctcgccg ccgagggcgc cgcaccccgc      3060
     aagatccgca ccccgctgtc gctcacccac catccgcgca gcccgctcac cgtcgaggag      3120
     gtgctggacc gggcgcgcgg cggtcaggga cgcagcacgt ag                         3162
//

If you have problems or comments...

PBIL Back to PBIL home page