(data stored in SCRATCH zone)

EMBL: CP002399.PE262

CP002399.PE262       Location/Qualifiers
FT   CDS_pept        complement(263776..264690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0263"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: fre:Franean1_4770 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05816"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADU05816.1"
FT                   /translation="MGTRTFRAAVVRTPGGPDTIEIIDVPEREPGPGEVRVDVAAAPVN
FT                   PADLGVVGGFFHSLGLIHQPHHTGLGWDFAGVVAAAGPGVDLAVGTRVAGLVGGFDRDF
FT                   GTYAEQLVVAAADVAVVPDDLDLVAAATVPLNGQTAAQIVDLLGDPPADGRLLVTGAAG
FT                   AVGGYVVPLARDRGWRVTGLARAGDEKFVRGLGADFTTAAEPGWDAVADAAGWQDQGLA
FT                   LVGDGGVFVGVRPNAHPAAERGVTVRAVDVRPDGARLADLLARTAAGELPARVHAVLPL
FT                   DRVADAHRAVAEGGVRGRYVLRP"
     atgggtacgc gtaccttccg cgccgccgtc gtccgcactc cgggcggacc ggacacgatc        60
     gagatcatcg acgttccgga gcgcgagccg gggcccggcg aggtccgggt ggacgtcgcg       120
     gcggcaccgg tcaacccggc cgacctcggg gtcgtcggcg gcttcttcca ctcgctgggg       180
     ctcatccacc agccgcacca caccggcctg ggctgggact tcgccggtgt cgtcgccgcg       240
     gccgggccgg gcgtcgacct cgccgtgggc acccgggtcg ccgggctggt cggcgggttc       300
     gaccgcgact tcggcacgta cgccgagcag ctcgtcgtag ccgcggccga cgtcgccgtc       360
     gtacccgatg atctggatct ggtggcggcg gcgacggtgc cgctcaacgg ccagaccgcg       420
     gcgcagatcg tcgacctgct cggcgaccct cccgccgacg gccggctgct cgtcaccggc       480
     gcggccggcg cggtgggcgg ctacgtcgtg ccgctcgccc gggaccgggg atggcgggtg       540
     accggcctgg cgcgggccgg ggacgagaag ttcgtccgcg gactcggggc cgacttcacc       600
     acggcggccg agccgggctg ggacgctgtc gccgacgccg ccggatggca ggaccagggg       660
     ctcgcgctgg taggcgacgg cggcgtgttc gtcggcgtac ggccgaacgc ccacccggcc       720
     gccgaacgcg gtgtcacggt gcgcgcggtc gacgtgcgcc ccgacggggc acgcctggcc       780
     gacctgctcg cccgcaccgc agccggtgag ctgccggccc gggtgcacgc ggtcctgccg       840
     ctggaccggg tggcggacgc gcaccgggcg gtggccgagg gcggggtacg cggacgctac       900
     gtgctgcgtc cctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page