(data stored in SCRATCH zone)

EMBL: CP002399.PE272

CP002399.PE272       Location/Qualifiers
FT   CDS_pept        272641..273303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0274"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: sro:Sros_8793 response regulator receiver
FT                   protein; PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05826"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU05826.1"
FT                   /translation="MIRLLLADDQTLVRAGFRSILDGEDGIEVVGEAADGTTAVRLTRE
FT                   RRPDVVLMDIRMPLLDGLAATREIVAGTDARVIILTTFDLDDYVYGALRAGASGFLVKD
FT                   TEPAELIHGVRVVARGDALIAPAVTRRLIAEFAARTRHPEPGPRLNALTEREREVLALV
FT                   AAGLSNDEIAARLVLSPATAKTHVSRIMTKTRVRDRAQLVVLAYESGLTVPGWLTAS"
     atgatccggt tgctgctcgc cgacgaccag accttggtac gcgcgggctt ccgctccatc        60
     ctcgacggcg aggacggcat cgaggtggtc ggcgaggccg ccgacggcac cactgcggta       120
     cggctgacgc gggaacgacg gccggacgtc gtcctcatgg acatccggat gccgctgctg       180
     gacgggctgg ccgctacccg ggagatcgtc gccggcaccg acgcccgcgt gatcatcctg       240
     accacgttcg acctggacga ctacgtctac ggcgcgttgc gggccggcgc gagcggcttc       300
     ctggtcaagg acaccgagcc ggcggagctg atccacggcg tacgggtggt ggcgcggggc       360
     gacgcgttga tcgccccggc cgtcacccgc cggctgatcg ccgagttcgc cgcccggacc       420
     cggcacccgg agccgggccc ccggctgaac gcactcaccg agcgggagcg ggaggtgctc       480
     gccctggtcg ccgccggcct gtcgaacgac gagatcgcgg cccggctggt gctgagcccg       540
     gccaccgcga agacgcacgt cagccggatc atgaccaaga cgcgggtacg ggaccgggct       600
     cagctcgtgg tgctcgcata cgagtcgggg ctcaccgtcc ccggctggct caccgcctcc       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page