(data stored in SCRATCH zone)

EMBL: CP002399.PE274

CP002399.PE274       Location/Qualifiers
FT   CDS_pept        273937..274236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa35350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05828"
FT                   /inference="similar to AA sequence:KEGG:nfa35350"
FT                   /protein_id="ADU05828.1"
FT                   /translation="MRVTSTAAVAASREVPGDDGVRRPGGEVHAWLPGRNQTLCGLPLS
FT                   RTRLRRFPHVPFDYSGTDVLTDADPEGWLCPRCLAATSGRRDREKGWARTNPRP"
     atgcgagtca cgagcaccgc cgccgtggcg gcgtcccgcg aggtgccggg cgacgacggc        60
     gtacgccgcc ccggcggtga ggtgcacgcc tggctgccgg gccggaacca gacgctctgc       120
     gggctgccgc tgagccggac ccggctgcgc cgcttcccgc acgtgccgtt cgactactcc       180
     ggcaccgacg tactcaccga cgctgacccg gagggctggc tctgcccgcg ttgcctggcc       240
     gccacctcgg gtcgccgcga tcgggagaag ggctgggcgc ggacgaaccc ccgtccgtga       300
//

If you have problems or comments...

PBIL Back to PBIL home page