(data stored in SCRATCH zone)

EMBL: CP002399.PE279

CP002399.PE279       Location/Qualifiers
FT   CDS_pept        complement(279150..279869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0281"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: saq:Sare_4532 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05833"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ADU05833.1"
FT                   /translation="MTLILRSAILNDVGLVRTNNEDSALAGDRLVAVADGMGGLPAGEV
FT                   ASEIVIRILDELTPPTGADEAADALRAVVSTANQRIRAAITVDPARDGMGTTLTAALLA
FT                   GDTLVLAQVGDSRCYLLRDHELTQLTRDDTFVQALVDQGALSRDQARHHPQRSLVTRAV
FT                   QGSDAPPAVGALTVFPGDRLLLCSDGLSDYVEDAAIAAALATYGDRQQCGEQLVKLAHQ
FT                   AGAPDNVTVVISDVTEA"
     atgacgctca tcctccgctc ggccatcctc aacgacgtcg gcctcgtccg gaccaacaac        60
     gaggactccg ccctcgccgg tgaccgcctc gtggcggtgg ccgacggcat gggcgggctc       120
     cccgccggcg aggtggccag cgagatcgtc atccggatcc tggacgagct gacgccgccc       180
     accggcgccg acgaggccgc cgacgcgctg cgcgccgtcg tcagcaccgc gaaccagcgc       240
     atccgcgcgg ccatcacggt ggacccggcc cgcgacggca tgggtacgac gctcaccgcc       300
     gccctgctcg ccggggacac cctggtcctg gcccaggtcg gcgactcccg ctgctacctg       360
     ctgcgcgacc acgagctgac ccagctcacc cgcgacgaca cgttcgtcca ggcgctcgtc       420
     gaccagggcg cgctctcccg cgaccaggcc cggcaccacc cgcagcgctc gctcgtcacc       480
     cgggcggtgc agggctcgga cgcgccgccc gccgtcgggg cgctcaccgt cttccccggc       540
     gaccggctgc tgctgtgcag cgacggcctc tccgactacg tggaggacgc cgccatcgcc       600
     gcggcactcg ccacctacgg ggaccgccag cagtgcggcg aacaactggt gaaactggcc       660
     caccaggccg gcgcgccgga caacgtgact gtggtcatct cggacgtcac cgaggcgtga       720
//

If you have problems or comments...

PBIL Back to PBIL home page