(data stored in SCRATCH zone)

EMBL: CP002399.PE298

CP002399.PE298       Location/Qualifiers
FT   CDS_pept        293937..295448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0300"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   sma:SAV_5387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05852"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADU05852.1"
FT                   /translation="MRPGTLLRLVLAGTRTDIARVVLTAVSAALATLAGLAALTVLSVV
FT                   KPSGDEGLNSDQYTNALLREPGLRPGVAFALLLLCVPVLGLAGQCARLGAPGRDRRLAA
FT                   FRLAGATPGQVTRVAVAETGVASLLGTLVGLAVFLAGCRLLHRPDADGRLPLPTDVHPA
FT                   PVAVAAVVLGLPLVAALVSALLLRRVATTPFGVVRKVRTRAPWPWPGVLILAALAMFAA
FT                   IRPLLLWYERRGAVAPDWLVPTLLVVGGLTAMIGVVSGTGWISYRTGRLLHRHGRGPAA
FT                   LLAARRLAADPWAGSRTFAALLAALIFGAGAAGLRADFQAEAEVTRRTGSGMADPGFYL
FT                   GAMDLVDLAVLVAMAIAGGGLLVAVVEGITSRRRAYAAQVATGVPRATIGRSLLWAALA
FT                   PAVPAIGLALTVGYLLVRGVMPAPSNGGFTRTICDAGSELCGDPATAARYTRTEWVPKT
FT                   TVPPDVPWDQLAWLAAGGLAAVLCTVVAGLLFLRTATSVEELRAG"
     gtgaggccgg ggacgctgct gcgtctcgtg ctggcgggca cccgcaccga catcgcacgg        60
     gtggtgctca cggcggtgag cgccgcgctc gcgacgctgg ccgggctggc cgcgctgacc       120
     gtgctgtcgg tggtgaagcc gtccggcgac gaagggctca actccgacca gtacaccaac       180
     gccctgctgc gggaacccgg tctgcgcccc ggcgtggcgt tcgcgttgct gctgctctgc       240
     gtaccggtcc tggggctggc cgggcagtgc gcccgcctcg gcgcgccggg ccgggaccgg       300
     cggctggccg cgttccggct ggccggtgcc acccccgggc aggtcacccg ggtcgcggtc       360
     gccgagaccg gcgtggcgag cctgctcggc accctcgtcg gcctggccgt cttcctggcc       420
     gggtgccggc tgctgcaccg gcccgacgcg gacgggcggc tgccgctgcc caccgacgtg       480
     cacccggccc cggtggcggt ggcagccgtc gtgctcggcc tgccgctggt cgccgcgctg       540
     gtgagcgcgt tgctgctgcg gcgggtcgcc accaccccgt tcggcgtcgt acgcaaggtc       600
     cgcacccggg cgccctggcc gtggccgggc gtgctcatcc tcgccgcgct ggcgatgttc       660
     gccgcgatcc gcccgctcct gctctggtac gaacggcgtg gcgccgtggc ccccgactgg       720
     ctggtgccga cattgctcgt cgtcggcggg ctgaccgcga tgatcggcgt ggtgtcgggc       780
     accggctgga tctcgtaccg gaccggccgg ctgctgcacc ggcacggacg cggcccggcc       840
     gccctgctcg ccgcccgccg gctggccgcc gacccgtggg ccggcagccg caccttcgcc       900
     gcgttgctgg ccgcgctgat cttcggcgcc ggtgccgcag ggctgcgtgc cgacttccag       960
     gccgaggccg aggtgacccg ccgcaccggc tccggaatgg ccgacccggg cttctacctc      1020
     ggcgcgatgg acctggtcga cctcgcggtc ctggtggcga tggcgatcgc cggcggtggg      1080
     ctgctcgtgg cggtggtcga ggggatcacc agccggcgac gggcgtacgc ggcgcaggtg      1140
     gcgaccggcg tgccacgggc caccatcggc cggtcgctgc tctgggccgc gctcgccccc      1200
     gccgtacccg cgatcgggct cgcgttgacg gtcggctacc tgctggtccg gggcgtcatg      1260
     ccggcaccga gcaacggcgg cttcacgcgg acgatctgcg acgccggctc ggaactgtgc      1320
     ggcgatccgg ccaccgcggc gcggtacacc cgtaccgaat gggtgccgaa gacgacagtt      1380
     ccgccggacg taccgtggga tcagctggcc tggctcgcgg cgggcgggct ggcggcggtg      1440
     ctgtgcacgg tcgtggccgg cctgctgttc ctgcgcaccg cgacgtcggt ggaggagctg      1500
     cgcgcgggct ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page