(data stored in SCRATCH zone)

EMBL: CP002399.PE299

CP002399.PE299       Location/Qualifiers
FT   CDS_pept        complement(295533..297626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0301"
FT                   /product="Oligopeptidase B"
FT                   /EC_number="3.4.21.83"
FT                   /note="KEGG: saq:Sare_4526 oligopeptidase B; PFAM:
FT                   peptidase S9A prolyl oligopeptidase domain protein
FT                   beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05853"
FT                   /inference="protein motif:PRIAM:3.4.21.83"
FT                   /protein_id="ADU05853.1"
FT                   /translation="MTETPPPVAKRVPTERLHHGDTVLDEYAWLAAKDDPDTIAYLDAE
FT                   NAYTEARTAHLAGLRAELFEETRRRTQETDLSVPTRKDGYWYYTRTVEGQQYGVHCRRA
FT                   VRPGETAPPVSADGAPLDGEEVLLDGNQIAEGHDFFSLGAFDVSPDGRWLAYSTDFSGD
FT                   ERFTLRIKDLTTGESLPDEVPDTFYGTAWSSDASTLFYVTVDEAWRPNRVWRHAVGTAS
FT                   TEDVVVYQEDDERFWVGVELTRSERFVVIDIHSKITSEVWVIPASNPTGEPAVVAPRRQ
FT                   GIEYAVEHHGHRFLILHNDGAEDFALAYTSADSPGEWEPLIPHTPGTRLEAVDAFENHL
FT                   VVSLRTNGLTGLRVLPVGTDDSWDIDFPEPIYSVGLDANPEYRTSEVRLRYTSLVTPDS
FT                   VYDYDLVTRELTLRRQKPVRPGPDGRAYDPADYEQHRDWALADDGTRVPISLVCRRDTP
FT                   RDGSAPAVIYGYGSYEASMDPWFSIARLSLLDRGVIFAVAHIRGGGELGRRWYDEGKLL
FT                   AKKNTFTDFVACARHLVKAGWTASDRLVARGASAGGLLMGAVANLAPDAFTGIVAQVPF
FT                   VDALTSILDPSLPLTVTEWEEWGNPLDDPEVYAYMKSYTPYENVATVEYPAILAVTSLN
FT                   DTRVLYHEPAKWIARLRSLAPAGDYLLKTEMGAGHGGPSGRYDSWREEAFVNAWILDRV
FT                   GRA"
     gtgaccgaaa ccccaccgcc cgtcgccaag cgcgtcccga ccgagcgcct tcatcacggt        60
     gacacagtcc tcgacgagta cgcctggctc gccgccaagg acgacccgga cacgatcgcg       120
     tatctggacg ccgagaacgc gtacaccgag gcgcgcaccg cccacctggc cggcctgcgc       180
     gcggagctgt tcgaggagac gcgccggcgc acccaggaga cggacctgtc ggtgccgacc       240
     cgcaaggacg gctactggta ctacacccgc acggtcgagg gccagcagta cggcgtgcac       300
     tgccggcgcg cggtccggcc gggcgagacg gcgcccccgg tcagcgcgga cggcgccccg       360
     ctcgacggcg aggaggtgct gctcgacggc aaccagatcg ccgaggggca cgacttcttc       420
     tcgctcggcg cgttcgacgt cagcccggac gggcgctggc tggcctactc caccgacttc       480
     tccggcgacg agcgcttcac gctgcggatc aaggatctga ccaccggcga gtcgctgccg       540
     gacgaggtac cggacacgtt ctacggcacg gcctggtcca gcgacgcgtc cacgctgttc       600
     tacgtgactg tggacgaggc gtggcggccg aaccgggtgt ggcggcacgc cgtcggcacg       660
     gcgtccaccg aggacgtggt ggtctaccag gaggacgacg agcggttctg ggtcggcgtc       720
     gagctgaccc gctccgagcg tttcgtggtc atcgacatcc acagcaagat caccagcgag       780
     gtgtgggtga tcccggcgtc caacccgacc ggcgagcccg ccgtcgtggc cccgcggcgt       840
     cagggcatcg agtacgcggt ggagcaccac ggccaccgct tcctgatcct gcacaacgac       900
     ggcgcggagg acttcgcgct ggcgtacacc tcggcggact cgccgggcga gtgggagccg       960
     ctgatcccgc acacccctgg cacccggctg gaggcggtcg acgcgttcga gaaccacctc      1020
     gtggtgtcgc tgcgcaccaa cggcctgacc ggcctgcggg tgctgccggt gggcaccgac      1080
     gacagctggg acatcgactt ccccgagccg atctacagcg tcgggctgga cgccaacccc      1140
     gagtaccgca cgagcgaggt gcggctgcgc tacacctcgc tcgtcacccc cgactcggtc      1200
     tacgactacg acctggtcac ccgggagctg acgctgcgcc ggcagaagcc ggtccgcccc      1260
     gggccggacg ggcgggcgta cgacccggcc gactacgagc agcaccggga ctgggcgctc      1320
     gccgacgacg gcacccgcgt accgatctcg ctcgtctgcc gccgcgacac cccgcgcgac      1380
     ggctcggcgc ccgccgtcat ctacggctac gggtcgtacg aggcgagcat ggacccgtgg      1440
     ttctcgatcg cccggctgag cctgctcgac cgcggcgtga tcttcgcggt ggcgcacatc      1500
     cggggcggcg gtgagctggg ccggcgctgg tacgacgagg gcaagctgct ggccaagaag      1560
     aacacgttca ccgacttcgt ggcctgtgcc cggcacctcg tgaaggcggg ctggacggcg      1620
     agcgaccggc tggtcgcccg gggcgcctcg gccggtggcc tgctgatggg cgcggtggcg      1680
     aacctcgccc cggacgcgtt caccggcatc gtcgcgcagg tgccgttcgt ggacgcgctc      1740
     acctcgatcc tcgacccgtc gctgccgctg accgtcaccg agtgggagga gtggggcaac      1800
     ccgctcgacg accccgaggt ctacgcgtac atgaagtcgt acacgccgta cgagaacgtg      1860
     gccaccgtcg aatacccggc gatcttggcg gtgaccagcc tcaacgacac gcgcgtgctc      1920
     tatcacgagc cggccaagtg gatcgcccgg ctgcggtcgc tcgcgccggc cggcgactac      1980
     ctgctcaaga ccgagatggg cgcgggccac ggcggcccga gcggccggta cgactcctgg      2040
     cgcgaggagg cgttcgtcaa cgcctggatc ctcgaccgcg tcggccgcgc ctga            2094
//

If you have problems or comments...

PBIL Back to PBIL home page