(data stored in SCRATCH zone)

EMBL: CP002399.PE305

CP002399.PE305       Location/Qualifiers
FT   CDS_pept        307386..308348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0307"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: amd:AMED_0299 ATPase component of ABC-type
FT                   multidrug transport system; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05859"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU05859.1"
FT                   /translation="METAIDVSGLVKTFGRTRALDGLDLTVRTGEVHGFLGPNGSGKST
FT                   TIRVLLGLLRADAGAVRLLGGDPWRDAVALHRRLAYVPGDVTLWPNLSGGEVIDLLGRL
FT                   RGGLDPRRRAELLESFELDPRKKGRTYSKGNRQKVGLVAALASDVELLILDEPTSGLDP
FT                   LMEEVFQHWVRRARQDGRTVLLSSHILAEVEALCDRVTIIRAGRTVESGTLGDLRHLHR
FT                   TAIDAEVAAPLDGLADLPGVHDLRVDGQRVRFDVDTASLDAALRRLTELGVRSLVSTPP
FT                   TLEELFLRHYETAPASGAAPASGVARSSDVARSETADRS"
     atggaaacgg caatcgatgt gtccggcctg gtgaagacct tcggccgcac acgggctctc        60
     gacgggctcg acctgaccgt ccgcaccgga gaggtgcacg gcttcctggg cccgaacggc       120
     tccggcaagt cgaccaccat ccgggtgctg ctcggcctgc tgcgggcgga cgcgggggcc       180
     gtccggctgc tgggcggcga cccctggcgg gacgcggtgg cgctgcaccg ccgcctcgct       240
     tatgtccccg gcgacgtcac gctctggccc aacctcagcg gcggcgaggt gatcgacctg       300
     ctcggccggc tgcgcggcgg gctcgacccg agacgccgtg ccgagctgct ggagtcgttc       360
     gagctggacc cgcgcaagaa gggccgcacc tactccaagg gcaaccggca gaaggtcggc       420
     ctggtcgccg cgctcgcctc cgacgtcgag ctgctcatcc tcgacgagcc gacctccggg       480
     ctcgacccgc tgatggagga ggtcttccag cactgggtcc gccgggcccg gcaggacggg       540
     cgcacggtgc tgctctccag ccacatcctg gccgaggtgg aggcgctctg cgaccgggtg       600
     acgatcatcc gggccggccg gacggtggag tccggcacgc tcggcgacct gcgccacctg       660
     caccgcaccg cgatcgacgc cgaggtcgcc gcgccgctgg acggcctggc cgacctgccc       720
     ggcgtgcacg acctgcgggt ggacgggcag cgggtccgtt tcgacgtgga caccgcgtcg       780
     ctcgacgccg cgctgcgccg gctcaccgag ctgggggtac gcagcctggt cagcacgccg       840
     cccacgctgg aggaactgtt cctgcggcac tacgagacgg cgcccgcctc cggcgcggcc       900
     cccgcctccg gcgtggcgcg ttcctccgac gtggcgcgtt ccgagacggc ggaccggtca       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page