(data stored in SCRATCH zone)

EMBL: CP002399.PE310

CP002399.PE310       Location/Qualifiers
FT   CDS_pept        313266..313898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0312"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: saq:Sare_4519
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05864"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADU05864.1"
FT                   /translation="MHVLRHGEVHNPDGILYGRLPGFRLSELGVQMAKAAAQALADRTV
FT                   VHVVASPLERAQQTAEPIAAQFGLSVGVDERLIESANWFEGKKVSPGDGSFRDPRNWWV
FT                   LRDPVTPSWGEAYRAIAERMFAALHAARVAAEGREAVLVSHQLPIWTLRRHVERKRLWH
FT                   DPRRRQCGLASLTSFHFDGAKIVGIGYSEPAAHLVSISPTARTAKGA"
     gtgcacgtgc tgcggcacgg cgaggtgcac aacccggacg gcatcctcta cggccgcctg        60
     cccgggttcc gcctctccga gctgggcgtg cagatggcca aggcggcggc gcaggcgctc       120
     gccgaccgga ccgtggtgca cgtggtggcc agcccgctgg agcgcgccca gcagaccgcc       180
     gagccgatcg cggcgcagtt cggtctctcc gtcggcgtcg acgagcgcct gatcgagagc       240
     gcgaactggt tcgagggcaa gaaggtctcg ccgggtgacg gctcgttccg cgacccgcgc       300
     aactggtggg tgctgcgcga cccggtgacc ccgtcctggg gcgaggcgta ccgggccatc       360
     gccgagcgca tgttcgccgc gctgcacgcc gcccgggtcg ccgccgaggg gcgggaggcg       420
     gtgctcgtgt cgcaccagct cccgatctgg acgctgcgcc ggcacgtcga gcgcaagcgc       480
     ctctggcacg acccgcgccg tcgccagtgc ggcctggcca gcctcacctc gttccacttc       540
     gacggcgcca agatcgtcgg tatcgggtac tccgagccgg cggcccacct cgtctcgatc       600
     tcgccgaccg cccggacggc caagggggcc tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page