(data stored in SCRATCH zone)

EMBL: CP002399.PE337

CP002399.PE337       Location/Qualifiers
FT   CDS_pept        340650..341819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0339"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   stp:Strop_4080 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05891"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADU05891.1"
FT                   /translation="MALRQAESAPNPAGTPDAPRPGARLLSRPGRRGARGAAGAPIRPA
FT                   GLRKRWLFAGVVAVLVALVAGVSLGPVSLPPGSVAAELLNLLPGVHLDSGLTEREVAII
FT                   TELRLPRVVLGLLVGALLALAGGCYQGVFRNPLADPYLLGVAAGAGFAVTAAIVLGAGA
FT                   GGALTGLPITIPLAAFVGSLGAVVLTYLLGAAGGRDRSPATLILAGVAVSAFFAAGQTY
FT                   LLQQHSDNIQQVYSWLLGRLATAGWHDVWLVLPYFVLTSVVVLLHRRELDVLSVGDDEA
FT                   AGLGLHPQRSRYLLIAAASLGTAAAVSASGLIGFVGIIVPHTMRLLAGSSHRVILPLSM
FT                   LFGGAFLALTDVVARTAAAPAEIPIGVVTALLGGPFFVLVLRTARRVAM"
     gtggccctac gacaggcgga atccgccccg aacccggccg ggacgcccga cgcgccccgg        60
     ccgggtgccc ggctgctgtc ccggccgggg cggcgtgggg cgcgcggcgc ggccggtgcc       120
     ccgatccggc ccgccgggct gcgcaagcgc tggctgttcg ccggtgtcgt ggcggtgctc       180
     gtcgcgctgg tcgcgggcgt ctcgctcggc ccggtcagcc tgccgcccgg cagcgtcgcg       240
     gccgaactgc tcaacctgct gcccggggtg cacctggaca gcgggctcac cgagcgggaa       300
     gtcgcgatca tcaccgagct gcggctgccc cgggtcgtgc tcggcctgct cgtcggcgcg       360
     ctcctcgccc tggccggcgg ctgctaccag ggcgtcttcc gcaacccgct ggccgacccg       420
     tacctgctcg gcgtggcggc cggagccgga ttcgcggtca ccgcggcgat cgtgctcggc       480
     gccggtgcgg gcggggcgct gaccgggctg ccgatcacca ttccgctggc cgcgttcgtc       540
     gggtcgctcg gcgcggtcgt gctgacgtac ctgctcggcg ccgccggtgg ccgggaccgg       600
     tccccggcca cgctgatcct ggccggggtg gcggtgtcgg cgttcttcgc cgccgggcag       660
     acgtacctgc tgcaacagca ctccgacaac atccagcagg tctactcctg gctgctcggg       720
     cggctggcca ccgccggctg gcacgacgtg tggctggtcc tgccgtactt cgtgctcacc       780
     tccgtggtgg tgctgctgca ccggcgtgaa ctggacgtgc tctccgtcgg cgacgacgag       840
     gccgccggtc tcggcctgca cccgcagcgc tcccgctacc tgctgatcgc cgccgcgtcg       900
     ctcggcaccg ccgccgccgt gtccgcgtcc gggctgatcg gcttcgtcgg catcatcgtg       960
     ccgcacacga tgcggctgct cgccggttcc agccaccggg tgatcctgcc gctgtcgatg      1020
     ctgttcggcg gcgcgttcct cgccctgacc gacgtggtcg cccggaccgc cgccgcgccc      1080
     gccgagatcc cgatcggcgt ggtcaccgcg ctgctcggcg gcccgttctt cgtgctggtc      1140
     ctgcggaccg cccgccgggt ggcgatgtga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page