(data stored in SCRATCH zone)

EMBL: CP002399.PE347

CP002399.PE347       Location/Qualifiers
FT   CDS_pept        complement(349094..351139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05901"
FT                   /inference="similar to AA sequence:KEGG:Sare_4482"
FT                   /protein_id="ADU05901.1"
FT                   /translation="MPATDLDATPSLDAELAAERAHLDASRAALTRMRERAEALFSTGD
FT                   KVAGDSYTAEQLGRHMARRVKELADDPTTPLFFGRLDFGGDDPDHAGREYHVGRRHVTD
FT                   ELGEPLVLDWRAPVSRSFYRASARDPQGVAVRRRFGFSAGTLTSFEDEHLDRGEELGTA
FT                   SRILTAEIERPRVGPMRDIVATIQPEQDELVRADLTDSICVQGAPGTGKTAVGLHRAAY
FT                   LLYLHRERLRRSGVLIVGPNRAFLSYIAAVLPALGEVEVEQATVEDLVARVPVRAVDDP
FT                   AAAALKHDVRMAEVLRRAVEAHIGTPTEPIMVSDGSYRWRIGLDPLHRLVTETRGEGLP
FT                   YATGRERVRARVVGLLQRQAEARRAESPSDAWLRRMSRIKPVTDLLDAVWPALTPDGLV
FT                   HRLRTDADALAAAADGLLTPEEQELFRSGKISRTAKATRWTAADAVLIDEVAGLLERPA
FT                   GFGHVVVDEAQDLSPMQCRAIARRSEHGSITLLGDLAQGTAPWAATDWRDSLAHLGKPD
FT                   AAVVPLSVGFRVPAAVVAFANRLLPALAVDVPPARSLRNDGALDVRTAEDLTAATVAEV
FT                   RAALAHDGSVGVIAADDAVDRLRAALADAGVETATADDVEAAARVTVVPATLVKGLEYD
FT                   HVVVVEPAAIVAAEPRGLHRLYVVLTRAVSRLAVLHREPLPAPLTA"
     gtgcccgcaa ccgaccttga cgccacaccg agcctcgacg ccgaactggc cgccgagcgt        60
     gcccacctcg acgcctcccg cgccgcgctg acccggatgc gggaacgcgc cgaggcgctc       120
     ttctccaccg gcgacaaggt ggccggagac tcgtacaccg ccgagcagct cggccggcac       180
     atggcccggc gggtcaagga gctggccgac gacccgacca ccccgctgtt cttcggccgc       240
     ctggacttcg gcggcgacga cccggaccac gccgggcggg agtaccacgt cgggcggcgg       300
     cacgtcaccg acgagctggg cgaaccgctg gtgctggact ggcgggcccc ggtctcccgg       360
     tccttctacc gggcgagcgc gcgcgacccg cagggtgtcg ccgtacgccg ccggttcggg       420
     ttcagcgccg ggacgctgac cagcttcgag gacgagcacc tggaccgggg cgaggaactc       480
     ggcaccgcca gccgcatcct caccgccgag atcgagcgcc cccgcgtcgg cccgatgcgc       540
     gacatcgtcg ccaccatcca gccggagcag gacgagctgg tccgggccga tctgaccgac       600
     tcgatctgcg tgcagggcgc gcccggcacc gggaagacgg cggtcgggct gcaccgcgcc       660
     gcgtacctgc tctatctgca ccgggaacgg ctgcgccgct cgggcgtgct gatcgtcggg       720
     ccgaaccggg cgttcctgtc gtacatcgcg gcggtgctgc ccgcgctcgg tgaggtcgag       780
     gtcgagcagg ccacagtgga ggacctggtc gcgcgggtgc cggtccgcgc ggtcgacgac       840
     ccggccgccg ccgcgctcaa gcacgacgtc cggatggccg aggtgctgcg ccgggccgtc       900
     gaggcccaca tcggtacgcc gaccgagccg atcatggtgt cggacggctc gtaccggtgg       960
     cggatcgggc tggacccgct gcaccggctg gtcaccgaga cccgcgggga agggctgccc      1020
     tacgccaccg gccgggagcg ggtccgggcg cgggtggtgg ggctgctgca acgccaggcg      1080
     gaggcgcgcc gggcggagtc accgagcgac gcctggctgc gccggatgag ccggatcaag      1140
     ccggtcaccg acctgctcga cgcggtctgg ccggcgctca ccccggacgg gctggtgcac      1200
     cggctgcgca ccgacgccga cgcgctcgcc gccgccgcgg acggtctgct cacgcccgag      1260
     gagcaggagc tgttccgctc cggcaagatc agccgcaccg cgaaggcgac ccggtggacc      1320
     gccgccgacg cggtactcat cgacgaggtg gccgggctgc tggaacggcc cgccggcttc      1380
     gggcacgtgg tggtcgacga ggcgcaggac ctctccccga tgcagtgccg ggccatcgcc      1440
     cggcgcagcg agcacggctc gatcacgctg ctcggcgacc tggcccaggg caccgcgccg      1500
     tgggcggcca ccgactggcg ggactccctg gcccacctgg gcaagccgga cgcggcagtg      1560
     gtgccgctga gcgtgggctt ccgggtgccc gccgccgtgg tggcgttcgc gaaccggctg      1620
     ctgccggcgc tcgccgtcga cgtacccccg gcccggtcgc tccgcaacga cggcgcgctc      1680
     gatgtgcgta ccgccgagga cctgacggcc gcgacggtgg ccgaggtgcg ggcggcgctc      1740
     gcgcacgacg gctcggtcgg tgtgatcgcg gcggacgacg cggtcgaccg gctccgcgcg      1800
     gcgctcgccg acgcgggcgt cgagaccgct acggccgacg acgtcgaggc cgcggcgcgc      1860
     gtcactgtgg tcccggcgac gctggtcaag ggcctggagt acgaccacgt ggtggtcgtc      1920
     gagccggctg cgatcgtggc cgccgagccg cgtgggctgc accgcctcta cgtggtgctg      1980
     acccgggcgg tctcccgcct ggccgtgctg caccgcgagc cgctgcccgc gccgctgacc      2040
     gcctga                                                                 2046
//

If you have problems or comments...

PBIL Back to PBIL home page