(data stored in SCRATCH zone)

EMBL: CP002399.PE352

CP002399.PE352       Location/Qualifiers
FT   CDS_pept        354122..354973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0354"
FT                   /product="protein of unknown function DUF178"
FT                   /note="PFAM: protein of unknown function DUF178; KEGG:
FT                   stp:Strop_4076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05906"
FT                   /inference="protein motif:PFAM:PF02621"
FT                   /protein_id="ADU05906.1"
FT                   /translation="MADRIARPRVGHIQFLNCLPIYWGLMRSGALIDVDLHKDSPDRLS
FT                   ADLVAGDLDIGPITLVEFLKHADDLLLLPDLAVGSDGPVLSVNVVSTRPLGELDGARVA
FT                   LGSTSRTGVLLAQLLLAERHGVRPEYFRCPPDLTQMLLEADAGVLIGDVALRALYEAPA
FT                   KGLEVTDLGQAWHDWTGLPMVFAVWAVRREFAAAHPGLVKEVHEAFLRSRDLCLAELDQ
FT                   VAEAAARWETFDAATLATYFRALDFSLGERQVAGLREFARRAAAHGEVPALPAGGPEFF
FT                   QG"
     atggccgacc gcatcgcccg cccccgggtg gggcacatcc agttcctcaa ctgcctgccc        60
     atctactggg ggctgatgcg gtccggcgcg ctgatcgacg tcgacctgca caaggactcg       120
     ccggaccggc tgagcgccga cctggtcgcc ggtgacctgg acatcggccc gatcacgctg       180
     gtggagttcc tcaagcacgc cgacgacctg ctgctcctgc ccgacctggc ggtcggcagc       240
     gacgggccgg tgctctcggt gaacgtggtg tccacccgcc cgctgggcga gctggacggc       300
     gcccgggtgg cgctcggctc cacctcgcgt accggggtgc tgctggccca gctgctgctc       360
     gccgagcggc acggcgtgcg cccggagtac ttccgctgcc cgccggacct gacccagatg       420
     ctgctggagg ccgacgccgg agtgctcatc ggcgacgtgg cgctgcgcgc gctctacgag       480
     gcgccggcca agggcctcga ggtgaccgac ctggggcagg cgtggcacga ctggaccggc       540
     ctgccgatgg tgttcgccgt ctgggcggta cgccgcgagt tcgccgccgc ccacccgggc       600
     ctggtcaagg aggtgcacga ggcgttcctg cgctcgcgcg acctgtgcct ggccgagctg       660
     gaccaggtgg cggaggcggc ggcccgctgg gagacgttcg acgcggccac gctcgccacg       720
     tacttccggg cgctcgactt ctcgctgggc gagcggcagg tggccgggct gcgcgagttc       780
     gcccgccggg cggccgcgca cggggaggtg ccggcgctgc cggccggcgg cccggagttc       840
     ttccagggct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page