(data stored in SCRATCH zone)

EMBL: CP002399.PE364

CP002399.PE364       Location/Qualifiers
FT   CDS_pept        364184..365440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0366"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; KEGG: saq:Sare_4466 cell wall anchor
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05918"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ADU05918.1"
FT                   /translation="MTFRYRSTLARAGVVALLSTAGLGAAAGPAQAADKADLQLIPLSY
FT                   QLAKGVSEAKAKPFKFQVNNTLGTVDAKDVRVTVETKGLKTAKVGVLVPAGCDIRGTTF
FT                   SCLLGDLPAGTTEDFGLPLFSTGGKGAAGTLTVSISAANGAGVLDTIDHDITVTEPGYD
FT                   LTTWVQDVYADVRVDGDDADESGLRPVRPGGTAPLDWAVFNDGSKRATGIKYGIALPAG
FT                   VTFAKLPDGCVEQNLGGFLNAYCEDLGAVLKPGQYYTADVRVTVGADVTEKLLRPGILW
FT                   AEGLDAASGAPEEEPRVASSAQRRAFAETDDGDNSAVFDVFVDQSPSTPSPTPTTQPTS
FT                   TPTAQPTPTGDATAVPTPTAGGGAGGGSGDGGLPVTGMQVGLIGGVGAAVLAAGAALMM
FT                   LSRRRKVVLVAPGEERTGD"
     atgaccttcc gctaccggtc cacgctggcc cgcgccggcg tcgtggccct gctctccacc        60
     gccggtctcg gcgccgccgc cggcccggca caggccgccg acaaggccga cctccagctc       120
     atcccgctca gctaccagct cgccaagggc gtcagcgagg cgaaggccaa gccgttcaag       180
     ttccaggtga acaacaccct ggggaccgtc gacgcgaagg acgtccgggt caccgtcgag       240
     acgaagggcc tcaagaccgc caaggtcggc gtgctggtcc cggccggctg cgacatccgt       300
     ggcaccacct tctcctgcct gctcggtgac ctgcccgccg gcaccactga ggacttcggt       360
     ctcccgctgt tctccaccgg cggcaagggc gcggccggca cgctcacggt ctcgatcagc       420
     gcggcgaacg gcgccggagt gctggacacg atcgaccacg acatcaccgt caccgagccg       480
     ggctacgacc tcacgacctg ggtccaggac gtgtacgccg acgtgcgcgt ggacggcgac       540
     gacgccgacg agtccggcct gcgcccggtc cggccgggcg ggaccgcgcc gctggactgg       600
     gccgtgttca acgacggcag caagcgcgcc accggcatca agtacgggat cgcgctgccg       660
     gccggtgtca ctttcgcgaa gctgcccgac ggctgcgtcg agcagaacct gggtggtttc       720
     ctcaacgcgt actgcgagga cctgggcgcg gtgctcaagc ccggccagta ctacaccgcc       780
     gacgtccggg tgactgtcgg cgcggacgtg accgagaagc tgctccggcc cggcatcctc       840
     tgggccgagg gcctggacgc ggcctcgggt gcgcccgagg aggagccgcg ggtcgccagc       900
     tcggcgcagc ggcgcgcgtt cgccgagacc gacgacggtg acaacagcgc ggtgttcgac       960
     gtcttcgtcg accagagccc gtcgaccccg agcccgacgc cgaccaccca gccgacctcg      1020
     acgccgaccg cccagccgac gccgaccggc gacgcgacgg cggtgccgac cccgaccgcc      1080
     ggtggtggcg cgggtggcgg tagcggcgac ggtggcctgc cggtgaccgg tatgcaggtc      1140
     ggcctgatcg gcggcgtcgg cgcggccgtg ctcgccgccg gcgcggcgct gatgatgctg      1200
     tcccgccgcc gcaaggtggt ccttgtcgct ccgggcgagg agcgcaccgg cgactga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page