(data stored in SCRATCH zone)

EMBL: CP002399.PE384

CP002399.PE384       Location/Qualifiers
FT   CDS_pept        386904..387686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0386"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: saq:Sare_4448 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05938"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADU05938.1"
FT                   /translation="MRDPLAEPSDLIRSVSRALRVLESVGRAPRGLTVKQIARRCELTV
FT                   ATTYHLVRTLAYEGYVIRREDGTYIVGLEVADRYRELVTAFRGPPAVGEALRRAASDTG
FT                   WSHYLGRFVGGQVAVTASAEGPRSPYMEDLVPGFDEGAHATALGKSLLATLTTEQRFRY
FT                   LREYGMRPFTTATLTTVEAFEADLAAGDRRGMQLELGQFRQGVACAAVLVSPDKDIERR
FT                   VVLACALPAGEMMTSARVVRAKLLTAARAIADGIASEN"
     gtgcgcgacc ccttggcgga accttcggac ctgatccgta gtgtgtctcg cgcgcttcga        60
     gtgctcgagt cggtcggccg tgcgccgaga gggctcaccg tgaagcagat cgcccggcgc       120
     tgcgagctga ccgtcgccac cacctaccac ctggtgcgca cgctcgcgta cgagggctac       180
     gtgatccggc gcgaggacgg gacgtacatc gtggggttgg aggtggccga ccgctaccgc       240
     gagctggtca ccgcgttccg ggggccgccg gcggtgggtg aggcgctgcg ccgcgcggcg       300
     tcggacaccg gctggagcca ctacctcggc cgtttcgtcg gcgggcaggt ggcggtgacc       360
     gcgtccgccg aggggccgcg ctcgccctac atggaagacc tggtgccggg cttcgacgag       420
     ggcgcgcacg ccaccgcgct gggcaagagc ctgctcgcca cgctcaccac cgaacagcgc       480
     ttccgctacc tgcgcgagta cggcatgcgc ccgttcacca ccgccaccct caccactgtc       540
     gaggcgttcg aggcggacct ggccgccggt gaccggcgcg gcatgcagct ggagctgggg       600
     cagttccggc agggcgtggc gtgcgccgcg gtgctcgtca gcccggacaa ggacatcgag       660
     cgccgggtgg tgctggcctg cgcgctgccg gccggcgaga tgatgacatc ggcccgggtg       720
     gtccgcgcca agctcctcac cgccgcgcgc gccatcgccg acgggatcgc ctccgagaac       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page