(data stored in SCRATCH zone)

EMBL: CP002399.PE391

CP002399.PE391       Location/Qualifiers
FT   CDS_pept        complement(393418..395220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05945"
FT                   /inference="similar to AA sequence:KEGG:Sare_4443"
FT                   /protein_id="ADU05945.1"
FT                   /translation="MTASTSERPASVPVRTSQWTSRPTARLRAGQIVATQVAAAVLVAA
FT                   AGRGVVPTAVALLSAALLLPAAWVRVRGRWLHEWLVTAAAYVTRRRALPPAADPAALLG
FT                   LLRPGSVVGATEASGGAAVLHDAAGLTALLELGDPDDLLGDHAHELPTPFDLLPPAGPD
FT                   APAIRLQLVFSSSPAPVPAVAGGPAGTSYRQLTDGRVAARARVVLVVQVLRADGWPDED
FT                   LLRALSGTLRRLVRRLGPLTARPLGGDAALRVIAELAHHEPGAPVRETWPLLTVGGLTQ
FT                   ATWRLRRWPDPRGEAARGLVGRLLALPATATTVALTAGPRTGTAPVPAELAVRVAAGSA
FT                   AGLSTAERTLRRIAGDVGGELRRLDGEHLAGLAATLPLAVTGGAASPAGSPPPALDLPS
FT                   ATAGLMVGANRHGAALTVRLFRPATTRVLLVGGVPAAQLLVLRALALGARVVVQTGRPR
FT                   FWEPFVRGVGTVGGGVPLLPPGRPAGGAPGSPLHPLLVVVDAGPVPPEAGPAAAWQSVL
FT                   VVRDELTSADTPALARADLAILQPLDPDEAALAGAALGLGGSAEWLTRIRDDMVAVVNR
FT                   RALRWALLSPTPVESQLVGRPARH"
     gtgaccgcga gcacgtccga gcggcccgcg tccgtcccgg tccgcacgtc acagtggacg        60
     agtcgtccga ccgctcgcct gcgcgccggc cagatcgtgg ccacccaggt cgcggcggcg       120
     gtgctggtcg cagccgccgg gcggggtgtc gtgccgacgg ccgtcgcgct gctgtcggcg       180
     gccctgctgc tgccggccgc gtgggtccgg gtgcgcggcc gctggctgca cgagtggctc       240
     gtcaccgctg ccgcgtacgt gacgcggcgg cgcgccctgc caccggcggc cgatccggcg       300
     gcgctgctgg ggctgctccg gccgggctcg gtggtcggcg cgaccgaggc gtccggcggg       360
     gcggccgtgc tgcacgacgc cgccgggctg accgccctcc tggagctggg cgacccggac       420
     gacctgctcg gcgaccacgc gcacgagctg cccacgccgt tcgacctgct tcccccggcc       480
     ggtccggacg cccccgcgat ccggctgcaa ctggtgttct cgtcgtcgcc cgcaccggtg       540
     cccgcggttg ccggcggtcc ggccgggacg tcgtaccgcc agctcaccga cgggcgggtg       600
     gccgcgcggg cacgggtggt gctggtcgtc caggtgctgc gcgcagacgg ctggccggac       660
     gaggacctgt tgcgggcact gtccggcacc ctgcggcgac tcgtccgccg gctcggcccg       720
     ctcaccgccc ggccgctggg cggcgacgcg gcgctgcggg tgatcgccga acttgcccac       780
     cacgaacccg gcgccccggt acgggagacc tggccgctgc tcactgtcgg tggcttgacg       840
     caggccacct ggcgactgcg ccggtggccg gatccgcgtg gcgaggcggc ccgagggctg       900
     gtgggccgcc tgctcgcact gcccgcgacc gccaccacag tcgcgctcac agccggtccg       960
     cgcaccggca ccgcgccggt cccggccgag ctggcggtac gggtggcggc cgggagcgcg      1020
     gccgggctgt cgacggcgga acgcacgctg cgccggatcg ccggtgacgt cggcggcgag      1080
     ttgcgccggc tcgacggtga gcacctcgcc gggctggccg ccacgctgcc gttggcggtg      1140
     accggcggtg ccgcgtcccc ggccgggtcg cctccgcccg cgctggacct gccctcggcc      1200
     accgccggcc tgatggtggg cgcgaaccgg cacggcgccg cactcaccgt ccgcctgttc      1260
     cgcccggcca cgacccgggt gctgctcgtg ggcggcgtgc ccgcggcgca actgctcgtg      1320
     ctgcgggcgc tggcgctcgg cgcgcgcgtg gtggtgcaga ccggccgccc ccgcttctgg      1380
     gagccgttcg tgcggggtgt cgggacggtc ggcggcggcg taccgctgct cccgccgggc      1440
     cgtccggccg gtggcgcgcc cggctcgccg ctgcacccgc tgctggtggt ggtggacgcc      1500
     ggcccggtgc cgccggaggc cggaccggca gccgcctggc agtcggtgct ggtggtccgc      1560
     gacgagctga cctcggccga cacgcccgcg ctggcccgcg ccgacctggc gatcctccag      1620
     ccgctcgacc cggacgaggc cgcgctggcg ggcgcggcgc tgggcctggg cggctccgcc      1680
     gagtggctca cccggatccg cgacgacatg gtggctgtgg tcaaccggcg ggccctgcgc      1740
     tgggcgctac tctcgcccac acctgtcgag tcgcaactgg tcggtcgccc ggcccggcac      1800
     tga                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page