(data stored in SCRATCH zone)

EMBL: CP002399.PE4

CP002399.PE4         Location/Qualifiers
FT   CDS_pept        5263..6393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: saq:Sare_0004 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05558"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADU05558.1"
FT                   /translation="MYVRRLELVDFRSYERVGVDLEPGPNVLVGANGVGKTNLVEALGY
FT                   VATLDSHRVATDAPLVRMGAASAVIRCAVVHEGRELLVELEIVPGKANRARLGRSPARR
FT                   ARDVLGALRLVLFAPEDLELVRGDPAERRRYLDDLLVTRQPRYAGVRADYERVVKQRNA
FT                   LLRTSYLARKTGGTRGGDLSTLAVWDAHLAQHGADLLAGRLELVAALTPHVAKAYDAVA
FT                   AGRGAAGIAYRPSVELPEPGADRAALAEALAAALTANRAAEIERGTTLVGPHRDDLALT
FT                   LGPLPAKGYASHGESWSYALALRLAGYDLLRADGIEPVLVLDDVFAELDTGRRERLAEL
FT                   VGGASQLLVTCAVDDDVPATLRGTRYAVGEGTVRRA"
     gtgtacgtcc gccggctcga actggtcgac ttccgctcgt acgagcgcgt cggcgtcgac        60
     ctggagccgg gtccgaacgt gctcgtcggc gccaacggcg tcggcaagac caacctggtc       120
     gaggcgctcg gctacgtggc gaccctggat tcgcaccggg tcgccaccga cgccccgctg       180
     gtgcggatgg gcgccgcctc ggcggtgatc cgttgcgccg tggtgcacga gggccgggag       240
     ctgctggtcg agctggagat cgtcccgggc aaggccaacc gggcccggct cggccggtcc       300
     ccggcccgcc gcgcccggga cgtgctcggc gcgctgcgcc tggtgctgtt cgcgccggag       360
     gacctggaac tggtccgcgg cgacccggct gaacgccgcc gctacctgga cgacctgctg       420
     gtcacccgcc agccccgcta tgccggtgtc cgcgccgact acgaacgcgt ggtcaagcaa       480
     cgcaacgcgc tgctgcgtac gtcgtacctc gctcggaaga ccggcggcac acgcggcggt       540
     gacctgtcga cgctggccgt gtgggacgcg catctggcgc agcacggcgc ggacctgctc       600
     gccggccgcc tggagctggt ggccgcgctg accccgcacg tggcgaaggc gtacgacgcg       660
     gtggcggccg gccgcggcgc ggcgggcatc gcgtaccggc cctcggtcga gctgcccgaa       720
     cccggcgccg accgcgcggc gctggcggag gcgctcgccg ccgcgctcac cgcgaaccgc       780
     gccgccgaga tcgagcgcgg caccacgctc gtcggcccgc accgcgacga cctggcgctg       840
     acgctcggcc cgctgcccgc caaggggtac gcgagccacg gcgagtcctg gtcgtacgcg       900
     ctggcgttgc ggctggccgg ttacgacctg ctgcgcgccg acgggatcga gccggtgctg       960
     gtgctcgacg acgtcttcgc cgagctggac accggccggc gggagcggct ggccgagctg      1020
     gtcggcggcg cgagccagct cctggtcacc tgcgcggtgg acgacgacgt gccggcgacg      1080
     ctgcgcggca cccggtacgc ggtgggcgag gggacggtgc gacgtgcctg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page