(data stored in SCRATCH zone)

EMBL: CP002399.PE420

CP002399.PE420       Location/Qualifiers
FT   CDS_pept        427645..428253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05974"
FT                   /inference="similar to AA sequence:KEGG:Sare_4409"
FT                   /protein_id="ADU05974.1"
FT                   /translation="MSLTPPTPKPARQPSLFSTEAADPALADLAGLLAGPGEVGRMGGT
FT                   ARISVVVDAAWRVHVLVAELGARGVPASWEPTEDGRHRVRTAYTSMLAPLARAWLRGAV
FT                   KRPPARFHLDGRRLRLWAAAAGTAEPAGFRLRLGPADEQSWPVVRAALAAVGLPAAFVE
FT                   PDEGGPAFRIGGRRMSRLAELVGERPATAPVADWPGSRG"
     gtgtcgctga cccctcccac cccgaaaccg gcccgccagc cctcgctgtt ctccaccgag        60
     gcggccgatc ccgcgctggc ggacctcgcc ggcctgctcg ccgggccggg tgaggtgggg       120
     cggatgggcg gcacggcccg gatctccgtg gtggtcgacg ccgcctggcg ggtgcacgtg       180
     ctggtggccg agctgggcgc ccggggtgtg ccggcgagct gggagccgac cgaggatggg       240
     cggcaccggg tgcgcaccgc gtacacgagc atgctggcgc cgctcgcgcg ggcctggctg       300
     cgcggcgcgg tgaagcggcc accggcccgt ttccacctgg acgggcggcg gctgcggctc       360
     tgggcggccg ccgccggcac ggccgagccg gccggattcc ggctgcggct cggaccggcc       420
     gacgagcagt cctggccggt ggtccgcgcc gcgctggcgg cggtgggtct gccggccgcg       480
     ttcgtggagc cggacgaggg cgggcccgcg ttccggatcg gcggacggcg gatgtcgcgg       540
     ctcgccgagc tggtggggga acggccggcg acggcgccgg tggcggactg gccgggctct       600
     cggggctga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page