(data stored in SCRATCH zone)

EMBL: CP002399.PE433

CP002399.PE433       Location/Qualifiers
FT   CDS_pept        complement(444893..445840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0436"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: amd:AMED_5881 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05987"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU05987.1"
FT                   /translation="MRSTAGRNHGASHPGWASWRPTARGYVGVVDGSNPLGEFLRARRE
FT                   TTSPAEAGIVSSGRRRTPGLRREEVAQLSGVSADYYARLEQGREQHPSEQMLNALARTL
FT                   GLDAEEAAHLHLLARSGRKPARRGTRETVRPSLLRLMDGWLHTPALIVDRRMDVLAANR
FT                   LGRALFAKLFEADEPNLVRFVFLDSAARSFHPHWDRVAQSSLGALRAAAADMLDDARLT
FT                   ELVGELSLKSPEFRRLWARHDVRGKTHEAKLFHHHDVGELTLTYDSLTVAGATGQQLVV
FT                   YQAEPGSRSAQALALLGTVAADLPAPGRRTRAAS"
     gtgcggagta cggccggtcg caaccacggt gcgtcacacc ccggctgggc ctcctggcgg        60
     ccgaccgccc gcggttatgt tggggtggtg gacggcagca acccgctcgg cgagttcctg       120
     cgcgcccggc gtgagacgac cagcccggcg gaggccggca tcgtctcctc gggccggcgc       180
     cggacgccgg gtctgcggcg cgaggaggtc gcccagctgt ccggggtcag cgccgactac       240
     tacgcccgcc tggagcaggg gcgggaacag cacccgtcgg aacagatgct gaacgccctg       300
     gcccgcaccc tcggactcga cgccgaggag gcggcgcacc tgcacctgct ggccaggagc       360
     ggccgcaagc ccgcccgcag gggtacgcgg gagaccgtcc ggccgagcct gctgcgcctg       420
     atggacggct ggctgcacac acccgcgctg atcgtcgacc gcaggatgga cgtgctggcc       480
     gccaaccggc tcggacgcgc cctgttcgcc aagctgttcg aggccgatga gcccaacctc       540
     gtccggttcg tcttcctcga ctcggcggcc cgttccttcc atccccactg ggaccgggtc       600
     gcgcagtcca gcctgggcgc gctgcgggcc gccgcagccg acatgctcga cgacgcgcgg       660
     ctcaccgaac tggtcgggga actctcgctg aagagtccgg agttccgccg gctgtgggcc       720
     cgccacgacg tacggggaaa gacgcacgag gcgaagctgt tccaccatca cgacgtcggc       780
     gagctgaccc tcacgtacga ctccttgacc gtcgccgggg cgacgggcca gcagctggtc       840
     gtctaccagg ccgagcccgg cagccggtcg gcgcaggcgc tggcgctgct gggcacggtg       900
     gccgccgacc tgcccgctcc gggcagaaga actcgggcgg cctcgtaa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page