(data stored in SCRATCH zone)

EMBL: CP002399.PE437

CP002399.PE437       Location/Qualifiers
FT   CDS_pept        449515..450099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lhk:LHK_02883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05991"
FT                   /inference="similar to AA sequence:KEGG:LHK_02883"
FT                   /protein_id="ADU05991.1"
FT                   /translation="MRRPLWLSLAYVLLAVAGGALLWLPFHTQMALDDWGVTLRERGTP
FT                   TQATVVDQVTKSGGNRSSSSRTMYFSYAVDGRTHSQEVPCFEVCRAAGTEVPIWVNPAD
FT                   PNDFVTDFGQLSGHRGRVQGVLGVVGLFALGAGVVLTLSRIRRAARPGDRAGRASHDAA
FT                   RRDRPRRVAPTPVGDGRGYTGRGKRKRNARR"
     atgcgtcggc cgctctggct cagcctcgcg tacgtgctgc tggcggtcgc cggtggcgcc        60
     ctgctctggc tgccgttcca cacccagatg gcgctcgacg actggggagt gacgctgcgc       120
     gagcggggta cgcccacaca ggcgacggtg gtcgaccagg tgacaaagag cggtggaaac       180
     cggagttcct cgtcgcgcac catgtacttc agttacgcgg tcgacggccg gacgcactcg       240
     caggaggtgc cctgcttcga ggtgtgccgg gccgcgggca ccgaggtgcc gatctgggtc       300
     aacccggcgg acccgaacga cttcgtcacc gacttcgggc agctcagcgg gcatcgcggg       360
     cgggtgcagg gcgtactcgg tgtggtcggg ctgttcgccc tgggcgccgg ggtggtgctg       420
     acgctgtccc gcatccggcg cgccgcccga ccaggcgacc gcgccggccg ggcgagccac       480
     gacgcggcgc gccgcgaccg gccgcgccgg gtggcgccga cgccggtcgg agacggtcgc       540
     ggctacaccg gccggggcaa acgcaagcgc aacgcccggc gctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page