(data stored in SCRATCH zone)

EMBL: CP002399.PE439

CP002399.PE439       Location/Qualifiers
FT   CDS_pept        450927..451433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05993"
FT                   /inference="similar to AA sequence:KEGG:Sare_4364"
FT                   /protein_id="ADU05993.1"
FT                   /translation="MESRLKVLGHPVHPMLVMFPVALFVTAVIFDVVDTVGGPGFLAEV
FT                   AYWNITVGLIGGLLAAAAGAFDLLALPAGTRAKRVGVTHAAANVAVILLFAAVWAVRLN
FT                   ADSRAAGGALVAIEVVALAILGVSAWLGGELVDRLGVGVDPEHDLNAPSSLRPSSATQR
FT                   IGDAR"
     atggagagcc gactcaaggt gctcggccat cccgtgcatc cgatgctcgt gatgttcccg        60
     gtggcgctct tcgtgaccgc ggtgatcttc gacgtggtgg acaccgtggg cgggcccggc       120
     ttcctggccg aggtcgcgta ctggaacatc accgtcggtc tgatcggcgg cctgctggcc       180
     gcggcggcgg gggcgttcga cctgctcgcc ctgccggccg gcacccgcgc caagcgggtc       240
     ggtgtcaccc acgccgccgc caacgtggcg gtcatcctgc tgttcgccgc ggtctgggcg       300
     gtccggctca acgccgactc ccgggcggcc gggggcgcgc tcgtcgccat cgaggtggtc       360
     gccctggcga tcctcggcgt gagcgcgtgg ctcggtggcg aactggtgga ccggctcggt       420
     gtcggcgtcg acccggagca cgatctcaac gcgcccagct cgctgcgacc ctcctcggcg       480
     acacagcgga tcggagacgc gcgatga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page