(data stored in SCRATCH zone)

EMBL: CP002399.PE443

CP002399.PE443       Location/Qualifiers
FT   CDS_pept        complement(453975..455813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0446"
FT                   /product="rfaE bifunctional protein"
FT                   /note="KEGG: saq:Sare_4360 RfaE bifunctional protein;
FT                   TIGRFAM: rfaE bifunctional protein;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase; PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05997"
FT                   /inference="protein motif:TFAM:TIGR02199"
FT                   /protein_id="ADU05997.1"
FT                   /translation="MAGAAAEERRLATVVASWQQRPVLVVGDAMLDEWRFAESERLCRE
FT                   APAPVLTLRRRISAAGGAANTAVNVAALGGRAALVAPVGADVAGDELHDCLDRAAVWDR
FT                   TVSQPGRPTPVKRRMLAGNQILLREDSGGPEDGLDADGVARLLTALHCATEELRAVAAG
FT                   QPLTLVVCDYGLGALPSAVRAWLVANRDRYGTVALDAHDLADWRGLNPTVVTPSFAEAT
FT                   RLLARAAAGFAHAERGAVPSGDVHLNHPAEADGPSELMVGAAPGGSGERVPGSPHPTSG
FT                   TPAAEVPAGPTGEPVPGEERVALTGDGLSVTGTGVTVSAAAGAGVDRAVLAESRLPELR
FT                   EHTGADVVAVTLDTEGAVVGGAEGEPRRSHSTPVPASHAVGAGDAYLAAMTLALAADAG
FT                   LPTAAQLAQLAATITVADTGTCVCRRQDLLAALGTGADEGGHPALVGADELAALVDEHR
FT                   QAGRSVVFTNGCFDVLHPGHVRYLTQARALGDLLIVAVNSDGSVRRLKGPDRPVNPVED
FT                   RIALLAALACVDHVVVFEEDSPARLIEAVRPDVYVKGGDYPPEMVPEAPLVRRLGGQVR
FT                   TLGYVPDRSTSAIIDRIRAHPVGDPVGDTVGEGRPA"
     atggcaggag cagcagcgga agagcgccgg ctggccaccg tcgtggcgag ctggcagcag        60
     cgtcccgtgc tggtcgtcgg ggacgccatg ctggacgagt ggcggttcgc cgagtcggag       120
     cggctctgcc gcgaggcgcc cgcgccggtc ctcaccctgc ggcggcggat ctccgctgcg       180
     gggggcgccg ccaacacggc ggtgaacgtc gcggcgctcg gcggccgggc cgcgctggtc       240
     gccccggtcg gcgccgacgt agccggcgac gagctgcacg actgcctgga ccgggcagcg       300
     gtctgggacc gcacggtgag ccagcccggc cggcccaccc cggtcaagcg gcggatgctc       360
     gccggcaacc agatcctgct ccgcgaggac tccggcggtc cggaggacgg gctggacgcc       420
     gacggcgtgg cccgcctgct gaccgcgctg cactgcgcca ccgaggagct gcgggcggtg       480
     gccgccggtc agccgctcac gcttgtggtc tgcgactacg gcctgggcgc gctgccgtcg       540
     gcggtacgcg cctggctggt cgccaaccgc gaccggtacg gcaccgtggc gctcgacgcg       600
     cacgacctgg ccgactggcg cgggctgaac ccgacagtgg tgacgccgag cttcgccgag       660
     gcgacccggc tgctggcccg cgccgccgcc gggttcgcgc acgccgagcg gggcgccgtc       720
     cccagcggtg acgtgcacct gaaccacccg gcggaggccg acggcccgtc cgagctgatg       780
     gtgggcgccg cgcccggcgg gtccggtgag cgcgtacccg gcagcccgca cccgacctcc       840
     ggtacgcccg cagccgaggt ccccgccggc ccgaccggcg aaccggtgcc gggcgaggag       900
     cgggtggcgc tgaccggcga cgggctgagc gtcaccggga ccggcgtgac tgtgagcgcg       960
     gcggccggcg ccggcgtgga ccgggccgtg ctggccgagt cacgcctgcc cgagctgcgc      1020
     gaacacaccg gcgccgacgt ggtggcggtg accctggaca ccgagggcgc ggtggtcggc      1080
     ggcgccgagg gcgagccccg gcgcagccac agcaccccgg ttccggccag tcacgcggtg      1140
     ggtgccgggg acgcgtacct ggcggccatg acgctggcgc tcgccgccga cgcgggcctg      1200
     cccaccgccg cccagctcgc ccagctcgcc gccaccatca ctgtggccga caccggcacc      1260
     tgcgtgtgcc gccggcagga cctgctggcc gcgctcggca ccggcgcgga cgagggcggg      1320
     catccggcgc tggtcggcgc cgacgagctg gccgccctgg tggacgagca ccggcaggcc      1380
     gggcggtcgg tggtgttcac gaacggctgc ttcgacgtgc tgcacccggg gcacgtccgc      1440
     tacctgaccc aggcccgcgc gctcggcgac ctgctcatcg tggcggtcaa ctcggacggc      1500
     agcgtacggc ggctcaaggg cccggatcgg cccgtcaacc cggtcgagga ccggatcgcc      1560
     ctgctggcgg cgctggcctg cgtcgaccac gtggtggtct tcgaggagga ctcgccggcc      1620
     cggctgatcg aggcggtccg gcccgacgtc tacgtcaagg gcggcgacta cccgccggag      1680
     atggtgccgg aggcgccgct ggtacggcgg ctgggcgggc aggtgcgcac gctcgggtac      1740
     gtaccggacc gctccacctc ggcgatcatc gaccggatcc gcgcccaccc ggtcggcgac      1800
     ccggtcggcg acacggtcgg cgagggcagg ccggcgtga                             1839
//

If you have problems or comments...

PBIL Back to PBIL home page