(data stored in SCRATCH zone)

EMBL: CP002399.PE447

CP002399.PE447       Location/Qualifiers
FT   CDS_pept        458803..460452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0450"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   saq:Sare_4358 long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06001"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADU06001.1"
FT                   /translation="MRSTMMDAPLQVARILEHGSTVHGAAEVVTWTGAEPRRMTYAEVG
FT                   RAAARLAHALRDECGVTGDERVGTFMWNNNEHLVAYFAVPSMGAVLHTLNIRLFPDQVS
FT                   YIANHAQDRVVLVDTTLIPLLARVIGEMTTVAHVVVVGGGDPAPLLTAAGDRITVHHWD
FT                   ALLADRPDHFDWPEVDERDAAALCYTSGTTGNPKGVAYSHRSIYLHSLQVCMPEGFGLG
FT                   PNDRELAIVPMFHAMSWGLPYAAFLSGASLIMPDRFLQAEPIAAMIAAERPTLAGAVPT
FT                   IWTDLLAYLDAHEVDLSSLKEVIVGGSACPPALMHAFHDRYGIDVIHAWGMTEMSPLGS
FT                   VSRAPAGATGDDAWRYRYTQGRVPAGVTARIVGPAGEPLPADGTSVGELEVRGPWVTAR
FT                   YIGDDAPEEEKFRDGWLRTGDVGTLSPDGYITLTDRAKDVIKSGGEWISSVELENALMA
FT                   HPAVLEACVVGVPDERWDERPLATVVIREGASVTAEELRDFLAGSVARWQLPERWAFID
FT                   AVPKTSVGKFDKKVVRSRYADGGLDVRELTAS"
     atgcgtagca cgatgatgga tgcccctctc caggtcgccc ggatcctcga acacggctcc        60
     accgtgcacg gcgcggcgga ggtggtcacc tggaccggcg ccgaaccccg ccggatgacg       120
     tacgcggagg tcggccgcgc cgccgcccgg ctggcccacg cgctgcgcga cgagtgcggg       180
     gtgaccggcg acgagcgggt cggcacgttc atgtggaaca acaacgagca cctggtggcg       240
     tacttcgccg taccgagcat gggcgcggtg ctgcacacgc tcaacatccg actcttcccc       300
     gaccaggtct cctacatcgc caaccacgcg caggaccggg tggtcctcgt cgacaccacg       360
     ctcatcccgc tgctcgcccg ggtgatcggc gagatgacca ccgtggcgca cgtggtggtg       420
     gtcggcggcg gtgacccggc gccgctgctg accgcggccg gcgaccggat cacagtgcac       480
     cactgggacg cgctgctggc cgaccgcccg gaccacttcg actggccgga ggtggacgag       540
     cgtgacgccg ccgccctctg ctacacctcc gggaccaccg gcaaccccaa gggcgtcgcc       600
     tactcgcacc gctcgatcta cctgcactcg ctccaggtct gcatgccgga gggcttcggg       660
     ctcggcccga acgacaggga actggcgatc gtgccgatgt tccacgcgat gtcctggggc       720
     ctgccgtacg cggcgttcct gtccggcgcc tcgctgatca tgccggaccg gttcctccag       780
     gccgagccga tcgccgcgat gatcgccgcc gagcgcccca cgctcgccgg ggcggtgccg       840
     accatctgga ccgacctgct ggcctacctg gacgcgcacg aggtggatct ctcctcgctg       900
     aaggaggtca tcgtcggcgg atcggcctgc cctccggcgc tgatgcacgc gttccacgac       960
     cggtacggca tcgacgtcat ccacgcctgg ggcatgaccg agatgtcgcc gctgggctcg      1020
     gtctcccggg caccggccgg cgccaccggc gacgacgcct ggcgctaccg ctacacgcag      1080
     ggccgtgttc cggccggcgt gacggcgcgg atcgtcggcc cggccggcga gccgctgccc      1140
     gccgacggga cgtcggtggg cgagctggag gtacgcgggc cgtgggtgac cgcgcggtac      1200
     atcggcgacg acgccccgga ggaggagaag ttccgggacg gctggctgcg gaccggtgac      1260
     gtcggcacgc tctcgccgga cggctacatc acgctcaccg accgcgccaa ggacgtgatc      1320
     aagtcgggtg gggagtggat ctcctcggtc gagctggaga acgccctgat ggcccacccg      1380
     gcggtgctgg aggcgtgcgt ggtgggcgta ccggacgagc gctgggacga gcggccgctg      1440
     gccacggtgg taatccgcga gggcgcctcg gtgaccgcgg aggaactgcg ggacttcctc      1500
     gccggctcgg tggcccgctg gcagttgccg gagcgctggg cgttcatcga cgcggtgccg      1560
     aagacgagcg tcggcaagtt cgacaagaag gtggtgcgct cgcggtacgc cgacggcggg      1620
     ctcgacgtgc gggaactgac cgcgtcgtaa                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page