(data stored in SCRATCH zone)

EMBL: CP002399.PE466

CP002399.PE466       Location/Qualifiers
FT   CDS_pept        complement(478156..479034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06020"
FT                   /inference="similar to AA sequence:KEGG:Strop_3789"
FT                   /protein_id="ADU06020.1"
FT                   /translation="MSDATGVIHDIGYQRYTGPRLGRRQVFGALYLHGVRTVFGLGRSA
FT                   KAKIFPWLVVSVVTVVAAGVTAVRSQIGEVVMTYAQFADAMSWLVIFFAAVAAPELVSR
FT                   DLRSGVLPLYFSRPLPRGDYALSKLLALVTALWLLLGGPQLVMFLGAAFTTNRGVRGVW
FT                   DELLDLLPGLLYAGLWAVVFASIALLVASLTGKRAFAAGGIVAVFLMTTPVVGVLSILP
FT                   SRTINELAFVASPPTLVGGVGNWALGDRLTQGRGGMPIGDFGPVYAVAAVLLVAACVSL
FT                   LLLRYRKVAAR"
     atgtctgacg cgaccggggt catccacgac atcggctacc agcgctacac cggtccgcgg        60
     ctcggccgcc ggcaggtctt cggcgcgctc tacctgcacg gcgtgcgtac cgtcttcggg       120
     ctgggccgca gcgccaaggc caagatcttc ccgtggctgg tcgtctccgt ggtcacagtg       180
     gtggccgccg gcgtcaccgc ggtacgcagc cagatcggcg aggtggtgat gacgtacgcc       240
     cagttcgccg acgcgatgag ctggctggtc atcttcttcg ccgcggtggc cgcgcccgag       300
     ctggtctccc gcgacctgcg cagcggcgtg ctgccgctgt acttctcccg gccgctgccg       360
     cgcggcgact acgccctgtc caagctgctg gcgctggtga ccgcgctgtg gctgctgctc       420
     ggcggcccgc agctggtgat gttcctcggc gccgcgttca ccacgaaccg gggtgtacgc       480
     ggggtgtggg acgaactgct cgacctgctg cccgggctgc tctacgccgg gctgtgggcg       540
     gtggtgttcg cctcgatcgc cctgctcgtc gcctcgctca ccggcaagcg cgcgttcgcc       600
     gccggcggca tcgtggcggt cttcctgatg accacgccgg tcgtgggcgt gctgtccatc       660
     ctgccctcgc ggacgatcaa cgagctggcc ttcgtggcct ctccgccgac gctcgtcggc       720
     ggcgtgggca actgggcgct cggcgaccgg ctgacccagg gacggggcgg catgccgatc       780
     ggcgacttcg ggccggtcta cgccgtggcc gccgtgctgc tggtcgccgc ctgcgtcagc       840
     ctgctgctcc tgcgataccg gaaggtggcc gcccgatga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page