(data stored in SCRATCH zone)

EMBL: CP002399.PE469

CP002399.PE469       Location/Qualifiers
FT   CDS_pept        482020..482808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0472"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: sro:Sros_7307 transcriptional regulator, DeoR
FT                   family; PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06023"
FT                   /inference="protein motif:PFAM:PF00455"
FT                   /protein_id="ADU06023.1"
FT                   /translation="MLARQRQTAILERLRRAGGVRVTELAAEFGVSDMTIRRDLDTLHE
FT                   QGLLAKVHGGATPAGPGSTDEPGFHAKSVRQSAEKAAIAEHAAGLVRPGAAIALSAGTT
FT                   TAELARRLVDVPGLTVVTNSLPVAEALHVGGRPDQTVVLTGGVRTPSDALVGPLAVAAI
FT                   AALHLDLLFLGVHGISERAGFTTPNLMEADTNRALVAAADRLVVLADHTKWGTVGISSI
FT                   VPLEAADVLVTDDRLAPEARRVLDDRVGELVTVPTTRGAE"
     atgctggcgc ggcagcggca gacggccatc ctggaacgac tgcgccgcgc cggcggcgtc        60
     cgggtcaccg agctggcggc cgagttcggc gtctccgaca tgaccatccg gcgcgacctg       120
     gacacgctgc acgagcaggg cctgctcgcc aaggtgcacg ggggcgcgac gccggccggt       180
     ccgggctcga ccgacgagcc cggcttccac gccaagtccg tccgccagtc ggcggagaag       240
     gccgccatcg ccgagcatgc cgcagggctg gtccggcccg gcgccgcgat cgcgctctcc       300
     gccggcacca ccaccgccga gctggcccgg cggctggtgg acgtgcccgg cctcacagtg       360
     gtcaccaact cgctgccggt ggcggaggcc ctgcacgtcg gcggccggcc cgaccagacg       420
     gtggtgctca ccggcggcgt acgcacaccg tcggacgcgc tcgtcggccc gctcgccgtg       480
     gccgcgatcg ccgcgctcca cctggacctg ctcttcctgg gcgtgcacgg gatcagcgaa       540
     cgggccggtt tcaccacccc caatctgatg gaggcggaca cgaaccgggc gctcgtggca       600
     gcggcggacc ggctcgtggt gctcgccgac cacaccaagt ggggcaccgt cggcatctcg       660
     tcgatcgtgc cgctggaggc ggcggacgtg ctggtcaccg acgaccggtt ggcacccgag       720
     gcccgacggg tactcgacga cagggtgggt gagctggtga cggtgcccac gacgaggggg       780
     gcggagtga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page