(data stored in SCRATCH zone)

EMBL: CP002399.PE470

CP002399.PE470       Location/Qualifiers
FT   CDS_pept        482805..483878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0473"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   KEGG: sro:Sros_7308
FT                   UDP-glucose--hexose-1-phosphateuridylyltransfera se; PFAM:
FT                   galactose-1-phosphate uridyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06024"
FT                   /inference="protein motif:TFAM:TIGR00209"
FT                   /protein_id="ADU06024.1"
FT                   /translation="MKRTQIALADGRELIYFDERDDAVRDQPDRRDLPPPPPASQLRYD
FT                   PLTDEWVAVAVHRQTRTFLPPADQCPLCPSRGERHSEIPAPDYDVVVFENRFPSLSQRV
FT                   ADEPAEITPFTPVRPGRGKCEVVCFTDDHNASFARLSPHRVRTVLDALADRTTALSALP
FT                   GVEQVFPFENRGVEIGVTLHHPHGQIYAYPFVTPRTRTMLAAARRYADRTGGNLYADVL
FT                   ATERASGDRVVTSNEHWTAYVPAAARWPFEVHVAPHRPVPDIPALDDAERDAFGPLYLD
FT                   LLRRFDGLFDLPMPYIAAWHQAPVRIDRELGHLHLQLFSIRRAKDKLKYLAGSESGMGV
FT                   FINDIAPERAAELLRAG"
     gtgaagcgta cgcagatcgc gctggccgac ggccgcgagc tgatctactt cgacgagcgg        60
     gacgacgcgg tccgcgacca gccggaccgg cgggacctgc cccctccccc gcccgcctcg       120
     cagctgcggt acgacccgct gaccgacgag tgggtggcgg tggcggtgca ccggcagacc       180
     cgcacgttcc tgcccccggc cgaccagtgc ccgctgtgcc cgtcccgcgg tgagcggcac       240
     agtgagatcc cggcacccga ctacgacgtg gtggtcttcg agaaccggtt cccctcgctg       300
     agccagcggg tggccgacga gccggccgag atcacgccgt tcaccccggt acgccccgga       360
     cgtggaaagt gcgaggtggt ctgcttcacc gacgaccaca acgcctcctt cgcccgcctc       420
     tccccgcacc gggtgcggac ggtgctggac gcgctcgccg accgcaccac cgcactgagc       480
     gcgctgcccg gcgtcgagca ggtcttcccg ttcgagaacc ggggcgtgga gatcggggtg       540
     accctgcacc acccgcacgg gcagatctac gcgtacccgt tcgtcacgcc gcgcacccgc       600
     acgatgctgg ccgccgcccg ccggtacgcc gaccgcaccg ggggcaacct ctacgccgac       660
     gtgctggcca ccgaacgcgc ctccggggac cgggtggtga cgagcaacga gcactggacc       720
     gcgtacgtcc cggcggcggc gcgctggccg ttcgaggtgc acgtggcgcc acaccggccg       780
     gtgccggaca tcccggcgct cgacgacgcc gagcgggacg ccttcgggcc gctctacctg       840
     gatctgctgc gccgcttcga cgggctgttc gacctgccga tgccgtacat cgcggcgtgg       900
     caccaggcgc cggtacggat cgacagggag ctgggccacc tgcaccttca gctgttcagc       960
     atccggcggg ccaaggacaa gctgaagtac ctcgccgggt cggagtccgg catgggcgtg      1020
     ttcatcaacg acatcgcccc ggaacgcgcc gccgaactgc tccgcgccgg atga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page