(data stored in SCRATCH zone)

EMBL: CP002399.PE479

CP002399.PE479       Location/Qualifiers
FT   CDS_pept        493403..494431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0482"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: saq:Sare_4180 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06033"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU06033.1"
FT                   /translation="MTATAEPAKVRGETILAVDQLVKHFPISQGVLFKKTIGQVKAVDG
FT                   VSFELRRGETLGVVGESGCGKSTLARLLMRLETPTAGRVTLEGRDLLRAAGADLRRLRR
FT                   NMQMVMQDPYTSLNPRMTVGDIIGEPFEIHPEAAPKRSRRQRVQELLDVVGLNPEHVNR
FT                   YPHQFSGGQRQRIGIARALALRPEIIVCDEPVSALDVSIQAQVINLLEQLQDELGLSYI
FT                   FIAHDLSVVRHISDRVAVMYLGRIVEIGTEEQIYQRATHPYTQALLSAVPVPDPEARDR
FT                   RTIIRLTGDVPSPAEPPSGCHFRTRCWKAEEVCATQDPQAVPRAADPHPSACHFAEVRT
FT                   EA"
     atgaccgcga cggctgaacc cgccaaggtg cgcggcgaga cgatcctcgc cgtcgaccag        60
     ctggtcaagc acttcccgat cagccagggc gtgctgttca agaagaccat cggccaggtc       120
     aaggcggtcg acggcgtctc gttcgagctg cggcgcggtg agacgctcgg cgtggtcggc       180
     gagtccgggt gcggcaagtc cacgctggcc cggctgctca tgcgcctgga gacgccgacc       240
     gccgggcggg tcacgctgga ggggcgcgac ctgctccggg cggcaggggc ggacctgcgc       300
     cggctgcggc ggaacatgca gatggtgatg caggacccgt acacctcgct gaacccgcgc       360
     atgactgtcg gcgacatcat cggcgagccg ttcgagatcc acccggaggc ggcaccgaag       420
     cgcagcaggc ggcagcgggt gcaggagctg ctggacgtgg tcgggctcaa cccggagcac       480
     gtcaaccgct acccgcacca gttctccggc ggtcagcggc agcgcatcgg catcgcccgg       540
     gcgctcgcgc tgcggcccga gatcatcgtc tgcgacgagc cggtgtcggc cctggacgtc       600
     tccatccagg cccaggtgat caacctgctg gagcagctcc aggacgagct ggggctgtcg       660
     tacatcttca tcgcccacga cctgtcggtg gtccggcaca tctccgaccg ggtggcggtg       720
     atgtacctgg gccggatcgt ggagatcggc accgaggagc agatctacca gcgcgcgacc       780
     cacccgtaca cccaggcgct gctgtcggcg gtgccggtgc ccgacccgga ggcccgcgac       840
     cggcggacca tcatccggct caccggcgac gtgccgagcc cggccgagcc gccgtccggc       900
     tgccacttcc ggacccgctg ctggaaggcc gaggaggtct gcgcgacgca ggacccgcag       960
     gcggtaccgc gcgcggcgga cccgcacccc agcgcctgcc acttcgccga ggtacgcacc      1020
     gaggcgtga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page