(data stored in SCRATCH zone)

EMBL: CP002399.PE486

CP002399.PE486       Location/Qualifiers
FT   CDS_pept        complement(500382..501269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0490"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: stp:Strop_3812
FT                   succinyl-CoA synthetase subunit alpha; SMART: CoA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06040"
FT                   /inference="protein motif:TFAM:TIGR01019"
FT                   /protein_id="ADU06040.1"
FT                   /translation="MAIWLTKDSKVIVQGMTGSEGSKHTRRMLAAGTNVVGGVNPRKAG
FT                   TTVDFDGTELPVFASVADAMKETGADVTVIFVPPQFTKAAVVEAIDAGIDLAVVITEGV
FT                   PVHDTAAFWAYNRAQGERTRIIGPNCPGIASPGASNAGIIPADITGSGRIGLVSKSGTL
FT                   TYQMMYELRDIGFSTCVGIGGDPIIGTTHIDALAAFEADPETDAIVMIGEIGGDAEERA
FT                   AEFIKANVTKPVVGYIAGFTAPPGKTMGHAGAIISGSAGTADAKKAALEAVGVKVGKTP
FT                   TETANLMREIMSGR"
     atggctatct ggctgaccaa ggactccaag gtcatcgtgc aggggatgac cggttccgag        60
     ggctccaagc acacccggcg gatgctcgcc gccggcacca acgtggtcgg cggcgtgaac       120
     ccgcgcaagg ccggcacgac cgtcgacttc gacggcaccg agctgcccgt cttcgcctcc       180
     gtcgcggacg cgatgaagga gaccggcgcg gacgtcaccg tcatcttcgt gccgccgcag       240
     ttcaccaagg ccgccgtggt cgaggcgatc gacgccggca tcgacctggc cgtggtgatc       300
     accgagggcg tgccggtgca cgacaccgcc gcgttctggg cgtacaaccg ggcccagggc       360
     gagcgcaccc ggatcatcgg cccgaactgc ccgggcatcg cctcgccggg cgcgtcgaac       420
     gccggcatca tcccggccga catcaccggc tccggccgga tcggcctggt cagcaagagc       480
     ggcacgctga cctaccagat gatgtacgag ctgcgcgaca tcggcttctc cacctgcgtc       540
     ggcatcggcg gtgacccgat catcggcacc acccacatcg acgccctggc cgccttcgag       600
     gcggacccgg agaccgacgc gatcgtcatg atcggtgaga tcggcggcga cgccgaggag       660
     cgggcggccg agttcatcaa ggccaacgtc accaagccgg tggtcggcta catcgccggc       720
     ttcaccgccc cgcccggcaa gaccatgggc cacgccggcg cgatcatctc gggctcggcg       780
     ggcaccgccg acgccaagaa ggcggcgctg gaggcggtgg gcgtcaaggt cggcaagacc       840
     ccgaccgaga ccgccaacct gatgcgggag atcatgtccg gccgctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page