(data stored in SCRATCH zone)

EMBL: CP002399.PE511

CP002399.PE511       Location/Qualifiers
FT   CDS_pept        complement(530864..532258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0515"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: saq:Sare_4225 peptidase M1 membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06065"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ADU06065.1"
FT                   /translation="MGRGRVWAAGLVTAALALSGCTGGDDNGFRPGAADAGDPYVPGAG
FT                   NGGYDVGHYALDVRYDPASDRLTGTATLTVTATRALSRFQLDLAGLDVERVRVDGEAVK
FT                   HRHDGAELIVTPSGGLPSGRRFTVEITYGGVPKPLPNAELGDGGFHATPDGAIALGQPE
FT                   SASTWYPVNDHPSDKATYDLAVTVPDGLAALSNGVPEGRTSSGGWTTWRWAERAPMASY
FT                   LSTLVIGDYRVSSGTHAGKPLVTAVAAALPADGPAAASVARTGEVADFLAARFGPYPFE
FT                   AYGGVVVADERIRYALETQSRPVYGPAFFRGDRPNTEVVAHELAHQWFGDSVSVARWSD
FT                   IWLNEGFATYAEWLWAEHDGGRTVAQTVVERYAATDWSRPTVDPGRAGMFGDAVYQRGA
FT                   LAVHALRRAVGDEAFYRVLRGWLAQHRDGNVTTADFIGYAERTSGRPLRALLDAWLVGG
FT                   TPPGLP"
     gtgggacggg ggcgggtctg ggcggcaggg ctggtgacgg cggcgctcgc gctgagcggg        60
     tgcaccggcg gcgacgacaa cgggttccgg ccgggcgcgg cggacgccgg tgacccgtac       120
     gtgccggggg ccggcaacgg cggctacgac gtgggccact acgcgctgga cgtgcgctac       180
     gaccccgcga gcgaccggct caccggcacc gccacgctga ccgtcaccgc cacccgggcg       240
     ctgtcccggt tccagctcga cctggccggg ctggacgtcg agcgggtgcg ggtggacgga       300
     gaggcggtga agcaccgcca cgacggcgcc gagctgatcg tcaccccgtc gggcgggctg       360
     ccgtccgggc ggcggttcac tgtcgagatc acgtacggcg gggtgccgaa gccgctgccg       420
     aacgccgaac tgggcgacgg cggattccac gccacaccgg acggtgcgat agcgctcggt       480
     cagccggagt cggcgagcac ctggtacccg gtcaacgacc acccgtcgga caaggccacc       540
     tacgacctcg cggtcaccgt gccggacggc ctcgccgcgc tgtcgaacgg cgtgccggag       600
     gggaggacgt cgagcggcgg ctggaccacc tggcgctggg cggaacgcgc gccgatggcc       660
     agctatctga gcacgctggt gatcggcgac taccgggtca gcagcggcac ccacgccggc       720
     aagccgctcg tcaccgccgt cgccgcggcg ctgcccgcgg acggtccggc cgccgcgtcg       780
     gtggcccgca ccggcgaggt cgccgacttc ctggccgcgc gcttcggccc gtacccgttc       840
     gaggcgtacg gcggcgtggt ggtcgccgac gaacgcatcc ggtacgcgct ggagacgcag       900
     agccgtccgg tctacgggcc ggcgttcttc cgcggggacc ggccgaacac cgaggtggtc       960
     gcgcacgagc tggcgcacca gtggttcggc gacagcgtct cggtggcccg gtggagcgac      1020
     atctggctca acgagggctt cgccacgtac gccgaatggc tctgggccga gcacgacggc      1080
     gggcgcacag tggcgcagac cgtcgtcgag cgctacgcgg ccaccgactg gtcgaggccc      1140
     acagtcgacc cgggccgggc cgggatgttc ggcgacgcgg tctaccagcg gggcgcgctc      1200
     gcggtgcacg cgctgcgccg cgcggtgggc gacgaggcgt tctaccgggt gctgcgcgga      1260
     tggctggcgc agcaccgcga cggcaacgtc accactgccg atttcatcgg gtacgccgaa      1320
     cgaacgtccg ggcggccgct gcgggcgctg ctggacgcct ggctggtcgg gggcacgcca      1380
     ccgggactgc cgtga                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page