(data stored in SCRATCH zone)

EMBL: CP002399.PE518

CP002399.PE518       Location/Qualifiers
FT   CDS_pept        complement(539071..540714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0522"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: saq:Sare_4231 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06072"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADU06072.1"
FT                   /translation="MAKILSFSDDARHLLEHGVNALADAVKVTLGPRGRNVVLDKKFGA
FT                   PTITNDGVTIAKEIELTNPYENLGAQLVKEVATKTNDVAGDGTTTATVLAQAMVREGLR
FT                   NVAAGTNPTGLKRGIDAAAAKVSEALLGKAVEVAGKESIAHVATVSAQDAAIGDLIAEA
FT                   MEKVGRDGVITVEEGSALTTELEVTEGLQFDKGFISPNFVTDLEAQEAVLEDPYILITT
FT                   QKISAIEELLPLLEKVLQNNKPLLIVAEDVEGQALSTLVVNALRKTVKVCAVKAPGFGD
FT                   RRKAMLQDMAILTGAELVAPELGYKLDQVGLEVLGTARRVVVDKENTTVVDGGGQASEV
FT                   ADRVAQIRKEIEASDSEWDREKLAERLAKLSGGIAVIKVGAATEVEMKERKHRIEDAIA
FT                   ATKAAVEEGTVPGGGAALAQILPALDDDLGFTGDEKVGVSIVRKALVEPLRWIAQNAGH
FT                   DGYVVVQKVVAQDWGHGLDAATGEYVDLAKSGIIDPVKVTRNAVSNAASIAGLLLTTES
FT                   LVVEKPAEPEPAAGGHGHSHGHGHQHGPGF"
     atggcgaaga tcctcagctt ctcggacgac gcccggcacc tgctcgagca cggtgtcaac        60
     gccctcgcgg acgcggtgaa ggtcaccctc ggcccgcgcg ggcgcaacgt cgtcctggac       120
     aagaagttcg gtgcgcccac gatcaccaac gacggcgtga ccatcgccaa ggagatcgag       180
     ctcaccaacc cgtacgagaa cctcggcgcg cagctggtca aggaggtggc gaccaagacc       240
     aacgacgtcg ccggcgacgg gaccaccacc gccaccgtgc tggcccaggc catggtccgc       300
     gagggcctgc gcaacgtggc cgccggcacc aacccgaccg gcctgaagcg gggcatcgac       360
     gcggcggccg ccaaggtctc cgaggcgctg ctcggcaagg ccgtcgaggt cgccggcaag       420
     gagtcgatcg cgcacgtcgc gaccgtctcc gcgcaggacg ccgccatcgg cgacctgatc       480
     gccgaggcga tggagaaggt cggccgcgac ggcgtcatca ccgtcgagga gggctccgcg       540
     ctcaccaccg agctggaggt gaccgagggt ctccagttcg acaagggctt catctcgccg       600
     aacttcgtca ccgacctgga ggcgcaggag gcggtcctgg aggacccgta catcctgatc       660
     accacccaga agatctcggc gatcgaggag ctgctgccgc tgctggagaa ggttctccag       720
     aacaacaagc cgctgctcat cgtcgccgag gacgtcgagg gccaggccct gtccacgctc       780
     gtggtcaacg cgctgcgcaa gaccgtcaag gtctgcgccg tcaaggcccc cggcttcggc       840
     gaccgccgca aggcgatgct ccaggacatg gcgatcctga ccggtgccga gctggtcgcc       900
     ccggagctgg gctacaagct cgaccaggtc ggcctggagg tgctcggcac cgcccgtcgc       960
     gtcgtggtcg acaaggagaa caccacagtc gtcgacggtg gcgggcaggc ctccgaggtc      1020
     gccgaccggg tcgcgcagat ccgcaaggag atcgaggcct ccgactccga gtgggaccgg      1080
     gagaagctgg ccgagcggct ggcgaagctc tccggcggca tcgccgtgat caaggtcggc      1140
     gcggccaccg aggtcgagat gaaggagcgc aagcaccgca tcgaggacgc catcgccgcg      1200
     accaaggccg cggtcgagga gggcacggtc ccgggtggcg gtgccgccct ggcccagatc      1260
     ctgccggcgc tcgacgacga cctgggcttc accggtgacg agaaggtcgg cgtctcgatc      1320
     gtgcgcaagg cgctcgtcga gccgctgcgc tggatcgccc agaacgccgg ccacgacggc      1380
     tacgtggtgg tgcagaaggt cgtcgcccag gactggggtc acggcctcga cgccgccacc      1440
     ggcgagtacg tcgacctggc caagtccggc atcatcgacc cggtgaaggt gacccgcaac      1500
     gcggtcagca acgccgcctc gatcgcgggc ctgctgctca ccaccgagag cctcgtggtg      1560
     gagaagccgg ccgagccgga gccggccgcc ggtgggcacg gccactcgca cggtcacggc      1620
     caccagcacg gcccgggctt ctga                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page