(data stored in SCRATCH zone)

EMBL: CP002399.PE535

CP002399.PE535       Location/Qualifiers
FT   CDS_pept        556490..557872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0539"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: sgr:SGR_252 putative secreted lipase; PFAM:
FT                   secretory lipase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06089"
FT                   /inference="protein motif:PRIAM:3.1.1.3"
FT                   /protein_id="ADU06089.1"
FT                   /translation="MSRRNTRPRTPSAAPSPRRTTGLRMLAVAAAAATYLAGSGAAAAA
FT                   DGTTPVVSRGVTIPAFYHPPADLPATNGTLIRTEPLPLGLSIPGLDGRPMPGTATRLMY
FT                   RSTDSNGRAVGVTGAYIEPSAAWRGAGPRPLVAVASGTMGQGDQCAPSFALQHPLTLTG
FT                   DTLSVGYEALAIYRLLATGAAVVVTDYVGLGATDRLHTYVNRLDEGRALLDAARAARTV
FT                   PGASVTDRSRVGLYGYSQGGGASAAAAELQPTYAPDVPLAGTYVGAPPADLTAVIGGID
FT                   GSALAGALGWSLNGFAQSDPAVRDVIEANVNDAGRAALTDTSTMCVGDAILRYAFTKSS
FT                   RWITGGRSLTAVIAASPEAAAVLDRQRIGTLKPAGPVRVATGVQDDIVPHRQARQLAVD
FT                   WCRKGANVTYQAVSLPNLGDKLLTNHLAPLITDQGDAVAWLTDRLAGRTAYSNCWTMPL
FT                   QP"
     gtgagcagga gaaacacccg tccccgcacg ccctccgccg ccccctcccc ccgccgcacg        60
     accggcctcc ggatgctggc cgtcgccgcg gcggcagcca cctacctggc cggatccggc       120
     gcagccgcag ccgccgacgg caccacgccg gtggtctccc gcggcgtgac gatccccgcc       180
     ttctaccacc cgcccgccga cctgcccgcc accaacggca cgctgatccg taccgagccg       240
     ctgccgctcg ggctcagcat ccccgggctc gacggccgcc cgatgcccgg caccgccacc       300
     cgcctgatgt accggtccac cgactccaac ggccgggccg tcggcgtgac cggcgcctac       360
     atcgaaccgt cggcggcgtg gcggggcgcc ggcccgcgcc cgctggtcgc cgtcgcctcc       420
     ggcacgatgg ggcagggcga ccagtgcgcg ccctcgttcg ccctgcaaca cccgctcacc       480
     ctcaccggcg acaccctgtc cgtcggctac gaggccctgg cgatctaccg cctcctcgcc       540
     accggcgccg cggtcgtcgt caccgactac gtcgggctgg gcgcgaccga ccggctgcac       600
     acgtacgtca accgcctcga cgagggacgt gccctgctcg acgcggcccg cgccgcccgc       660
     accgtgccgg gcgcgtcggt caccgaccgg tcccgcgtcg gtctgtacgg ctacagccag       720
     ggtggcggcg ccagcgccgc agccgccgaa ctccagccca cctacgcgcc cgacgtgccg       780
     ctggccggca cctacgtcgg cgcgccgccg gccgacctga ccgctgtcat cggcggcatc       840
     gacggcagcg cgctggccgg ggcgctgggc tggtcgctca acggcttcgc ccagtccgac       900
     ccggcggtgc gggacgtcat cgaggcgaac gtcaacgacg ccggccgggc ggcgctcacc       960
     gacacctcga ccatgtgcgt cggtgacgcc atcctccggt acgcgttcac caagagcagc      1020
     aggtggatca ccggcggccg gtccctcacc gctgtcatcg ccgcctcgcc cgaggcagcc      1080
     gccgtcctcg accggcagcg catcggcacg ctcaagcccg ccgggccggt acgcgtggcg      1140
     accggcgtcc aggacgacat cgtgccccac cggcaggccc gtcaactggc ggtcgactgg      1200
     tgccgcaagg gtgccaacgt gacctaccag gccgtcagcc tgcccaacct cggtgacaag      1260
     ctcctcacca accacctggc gccgctcatc accgaccagg gcgacgcggt ggcctggctg      1320
     accgaccggc tcgccgggcg caccgcctac tccaactgct ggacgatgcc ccttcagccc      1380
     tag                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page