(data stored in SCRATCH zone)

EMBL: CP002399.PE536

CP002399.PE536       Location/Qualifiers
FT   CDS_pept        complement(557869..558351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0540"
FT                   /product="Uncharacterized protein family UPF0079, ATPase"
FT                   /note="PFAM: Uncharacterised protein family UPF0079,
FT                   ATPase; KEGG: saq:Sare_4245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06090"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADU06090.1"
FT                   /translation="MTVVVELKTVEDTHEFGRRLAGVLRAGDLLLLSGPLGAGKTALTQ
FT                   GIGAGLGVRGDITSPTFVIARVHRPDPARGGRVTLVHADAYRLGEAADPRAEIDDLDLD
FT                   ASVDEAVTVVEWGEGMVEQLVDAHLRVRIDRRDDDTRAVTLEPVGGDWTARVAELS"
     atgacagtgg tcgtggagct gaagacggtc gaagacaccc acgagttcgg gcggcggctg        60
     gccggggtgc tgcgggccgg tgacctgctg ctgctcagcg gcccgctcgg cgccggcaag       120
     accgcgctga cccagggcat cggcgccggc ctcggcgtac gcggggacat cacctcgccc       180
     accttcgtca tcgcccgggt gcaccggccc gacccggcgc ggggcggccg ggtgacgctc       240
     gtgcacgccg acgcgtaccg cctgggtgag gccgccgacc cgcgcgcgga gatcgacgac       300
     ctcgacctgg acgcctcggt tgacgaggcg gtcaccgtgg tggagtgggg cgaggggatg       360
     gtcgagcagc tggtcgacgc gcacctgcgg gtacgcatcg accgccgcga cgacgacacc       420
     cgggcggtca cgctggagcc ggtcggcggc gactggaccg cccgggtcgc cgaactgtcc       480
     tag                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page