(data stored in SCRATCH zone)

EMBL: CP002399.PE537

CP002399.PE537       Location/Qualifiers
FT   CDS_pept        complement(558348..559433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0541"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: saq:Sare_4246
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06091"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADU06091.1"
FT                   /translation="MSVRLPRPRTAAGKVAGLVGAAVGVAAAGLAAGVVSERVLVRRLK
FT                   NDPTDRYADEVFGEQRYDEAYRLEMPDGTDIHVEVVEPTRPVAGHPTVVLVHGFCLDMG
FT                   TFHFQRKRLAERGDYRVVAYDQPGHGRSGRLESGEYDLTALGHTLRRVLDEVAPDGPLV
FT                   LVGHSMGGMTIMALAELYPEMFGDRVVGTVLMATSGGLAAETKLVAPALLGRVGSPVLY
FT                   MMSNATRYGGTVIDRARRSTSNVAWLLTRKYGFGTSKPSPALVSYVEMMNSRTSADTVT
FT                   RYLRTIATHSRFPALAALAGTPVLVIVGDKDMITPVTHSEEIVRRLPHAEFVKINDSGH
FT                   VVMLEHADEVNVALERFLDSL"
     atgagtgtcc ggttgccgcg accgcgtacc gctgccggca aggtggccgg gctggtcggc        60
     gccgccgtcg gcgttgccgc cgccgggctc gcggcgggcg tggtcagcga gcgggtgctg       120
     gtccgccggc tcaagaacga tcccaccgac cggtacgccg acgaggtctt cggtgagcag       180
     cgttacgacg aggcgtaccg gctggagatg ccggacggca ccgacatcca cgtcgaggtg       240
     gtcgagccga cccgccctgt cgcagggcac ccgactgtgg tgctggtgca cgggttctgc       300
     ctggacatgg gcacgttcca cttccagcgc aagcggctcg ccgagcgcgg cgactaccgg       360
     gtggtcgcgt acgaccagcc ggggcacggc cgttccggcc ggctggagag cggcgagtac       420
     gacctgaccg cgctgggcca cacgctgcgc cgggtgctcg acgaggtggc cccggacggc       480
     ccgctggtgc tggtcgggca ttcgatgggc ggcatgacga tcatggcgct ggccgagctg       540
     tacccggaga tgttcggtga ccgcgtggtc ggcaccgtgc tgatggccac ctcgggcggc       600
     ctcgcggcgg agaccaagct ggtggcgccc gcgctgctcg gccgcgtcgg ctcgccggtg       660
     ctctacatga tgagcaacgc cacccggtac ggcgggaccg tgatcgaccg ggcgcgccgg       720
     tcgacctcga acgtggcctg gctgctcacc cgcaagtacg gcttcggcac gtcgaagccg       780
     agcccggccc tggtgtcgta cgtcgagatg atgaactcgc gcacctcggc cgacacggtc       840
     acccgctacc tgcgcacgat cgccacccac tcccggttcc cggcgcttgc ggcgctggcc       900
     ggcacgccgg tgctggtgat cgtgggcgac aaggacatga tcacgccggt gacgcactcc       960
     gaggagatcg tccggcggct gccgcacgcc gagttcgtga agatcaacga cagtgggcac      1020
     gtggtgatgc tggagcacgc cgacgaggtg aacgtggcgc tggagaggtt cctggactcg      1080
     ctatga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page