(data stored in SCRATCH zone)

EMBL: CP002399.PE54

CP002399.PE54        Location/Qualifiers
FT   CDS_pept        complement(50732..52003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0054"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV_6301 antibiotic transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05608"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU05608.1"
FT                   /translation="MTITAVPGRDYRLLWSAAVCSQVGDSLRTPALALLAATLTRDPRA
FT                   VAAVTVAGLLPPLLFGLLSGVYADRWDRRRTMAVVDGGRAVVVAALAWSVATGHAGIAT
FT                   LVVVASLLALLGTLFDASAYALLPTVVPPERLAGANARLQAGTAVAGGFVGAPLAGVLF
FT                   AVSPALPFTADALTFALAAVLILAIPAPAPRRSCTFRPGKDAQKGQSRGHNRKINENKG
FT                   GVWEGIRFLRRDRVLWALTVGTAGSNLAIGGLASVLVLYALAVLRVPEAAYGLFAAGAI
FT                   AGGLGGALFAGRLAARFGTLPTLRVVLLGQTLALAGFALARHPLTGGLAMAGFTAGSTI
FT                   WNSLRAAYGQRHVPPDLLGRVGAAQRVAGLAAAPAGAVLAGLAAQAFGLTPVPWAAAAV
FT                   FALVTAAVWVTFRARTGPPAAPPH"
     atgacgatca ccgccgtccc gggccgcgac taccggctgc tctggtccgc cgccgtctgc        60
     tcgcaggtgg gggactccct gcgtacgccg gctctggccc tgctggccgc cacgctcacc       120
     cgcgaccctc gcgcggtagc cgcggtgaca gtggccgggc tccttccgcc gctgctgttc       180
     ggcctgctca gcggcgtgta cgcggaccgg tgggaccggc ggcggacgat ggcggtggtg       240
     gacggagggc gggccgtggt ggtggcggcg ctggcctggt cagtggcgac cgggcacgcc       300
     gggatcgcca cgctggtcgt cgtcgcgtcg ctgctcgccc tgctgggcac gctcttcgac       360
     gcgtccgcgt acgcgctgct gcccactgtg gtgccacccg aaaggctggc gggcgccaac       420
     gcccgcctcc aggccggaac cgcggtcgcg gggggattcg tcggcgcccc cttggccggt       480
     gtcctcttcg ccgtctcccc cgcactcccg ttcaccgccg acgccctgac cttcgccctg       540
     gccgccgtcc tcatcctcgc catccccgcc ccggctcccc gccgatcttg cactttccgc       600
     cctggcaagg acgcacaaaa aggacagtcg aggggccaca accgcaagat caacgagaac       660
     aagggtgggg tttgggaggg gattcggttt cttcgacgcg atcgggttct ctgggcgctg       720
     acagtcggga cggccgggtc gaatctggcc atcggagggc tggcctcggt gctcgtgctc       780
     tatgcgctgg ccgtgcttcg ggtgccggag gcggcgtacg ggctgttcgc ggccggcgcg       840
     atcgcgggcg ggctgggcgg cgcgctgttc gccggacggc tggccgcccg cttcggcacg       900
     ctgcccacgc tgcgtgtcgt gctgctcggt cagacgctgg cgctggccgg attcgcgctg       960
     gcccggcacc cgctgaccgg cggcctcgcg atggccgggt tcaccgccgg ctccacgatc      1020
     tggaacagcc tgcgggcggc gtacgggcag cggcacgtac ccccggatct gctcggccgg      1080
     gtgggcgcgg cacagcgggt ggccgggctg gccgccgcac cggccggcgc ggtgctggcc      1140
     ggtctcgccg cccaggcgtt cggcctgacg cctgtcccct gggcggccgc cgcggtcttc      1200
     gccctggtca cggccgccgt ctgggtgacc ttccgagcgc gcaccggacc gcccgccgcg      1260
     ccaccgcact ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page