(data stored in SCRATCH zone)

EMBL: CP002399.PE540

CP002399.PE540       Location/Qualifiers
FT   CDS_pept        562319..562621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_3480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06094"
FT                   /inference="similar to AA sequence:KEGG:Amir_3480"
FT                   /protein_id="ADU06094.1"
FT                   /translation="MVEKPFDVDPELLRSVARELADDAYRLARGPGAAPESLLVAAPDG
FT                   WRSAVALAELESAVRRWSGALGARVADTAQALRRGADGYEAVDERAARRLTGVLR"
     gtggtggaga aaccgttcga cgtcgacccg gagctgctgc gatcggtggc gcgcgagctg        60
     gccgacgacg cgtaccggct ggcccgcggg ccgggcgcgg cgccggagtc gttgctggtg       120
     gcggcaccgg acggctggcg atccgcggtg gcgctggccg aactggagtc ggccgtgcgg       180
     cgctggtccg gcgcgctcgg cgcccgggtg gccgacaccg ctcaggcgtt gcgccgcggc       240
     gcggacggct acgaggcggt cgacgaacgc gccgcccgcc gcctcaccgg ggtgctccgg       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page