(data stored in SCRATCH zone)

EMBL: CP002399.PE548

CP002399.PE548       Location/Qualifiers
FT   CDS_pept        complement(571860..572303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0552"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: saq:Sare_4254 50S ribosomal protein L13;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06102"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADU06102.1"
FT                   /translation="MRTYSPKPGEIERQWHVIDASDVVLGRLATHAATLLRGKHKPTFA
FT                   PHVDTGDFVVIVNAGKVALTGNKRQTKVAYRHSGYPGGLKRVGYDELLTKRPERAIELA
FT                   VKGMLPHNKLGRQLLKKLKVYAGAEHPHTAQQPVPFEIKQIAQ"
     gtgcgtacgt acagcccgaa gccgggtgag atcgagcgtc agtggcacgt catcgacgcc        60
     tctgatgtcg tgctgggccg cctggcgacc cacgccgcca cgctcctgcg tggcaagcac       120
     aagccgactt tcgcgccgca cgtcgacacg ggcgacttcg tcgtcatcgt gaacgcgggc       180
     aaggtcgcgc tgaccggcaa caagcgccag accaaggtcg cttaccgcca ctccggttac       240
     ccgggcggcc tgaagcgggt cggctacgac gagctgctca ccaagcggcc cgagcgggcc       300
     atcgagctgg ccgtgaaggg catgctcccg cacaacaagc tgggccgtca gcttctcaag       360
     aagctgaagg tctacgccgg tgccgagcac ccgcacaccg cgcagcagcc ggtgccgttc       420
     gagatcaagc agatcgcgca gtga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page