(data stored in SCRATCH zone)

EMBL: CP002399.PE554

CP002399.PE554       Location/Qualifiers
FT   CDS_pept        complement(575714..576424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0558"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: fal:FRAAL4892
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06108"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADU06108.1"
FT                   /translation="MSVADAFDAVAGSYDQARRRLVPCFDAFYGTAVEVAAPPLRAALA
FT                   AGRTPEVLDLGAGTGLLSLLLTAAVPGVRLTLVDGAPGMLAVAAGHLDARGVPHRTVHA
FT                   DLAGPLPAGRYDAVVSALAIHHLDDEGKRALYKRAADALVPGGVFVNAEQVAGPTPALD
FT                   RRYDEVWTARITELGSDAEEIAGARERMRHDRPAPVAEQCRWLTEAGLVDVDCFFKEWR
FT                   FAVFGGQRPDGSAR"
     atgagcgtgg cggacgcgtt cgacgcggtg gccggcagct acgaccaggc ccggcgccgc        60
     cttgtgccct gcttcgacgc cttctacggc accgctgtcg aggtggccgc acccccgctg       120
     cgcgccgcgc tcgccgccgg gcgtaccccc gaggtgctgg acctgggcgc gggcaccggc       180
     ctgctgtccc tgctgctgac cgcggccgtc cccggggtcc gcctgacgct cgtggacggc       240
     gcccccggca tgctcgcggt ggccgccggg cacctggacg cccgtggcgt gccgcaccgc       300
     actgtccacg ccgacctggc cggcccgctg cccgccggcc ggtacgacgc ggtggtctcc       360
     gcgctggcca tccaccacct cgacgacgag ggcaagcggg cgctgtacaa gcgggccgcc       420
     gacgcgctcg tccccggcgg ggtgttcgtc aacgccgagc aggtcgccgg gccgaccccc       480
     gcgctggacc gccgctacga cgaggtgtgg acggcgcgga tcaccgagct gggctccgac       540
     gccgaggaga tcgccggcgc ccgcgagcgg atgcggcacg accggccggc cccggtggcc       600
     gagcagtgtc gctggctgac cgaggcgggc ctggtggacg tggactgctt cttcaaggaa       660
     tggcgtttcg cggtcttcgg cggtcagcgg ccggacggat cggcgaggtg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page