(data stored in SCRATCH zone)

EMBL: CP002399.PE565

CP002399.PE565       Location/Qualifiers
FT   CDS_pept        complement(590403..591233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0569"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: stp:Strop_3877
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06119"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU06119.1"
FT                   /translation="MTQSTEARPEAPPRPAVRRGMAVRPAAVGLPALGLVIAVAAWWLV
FT                   TSGLNLVHPAALPPPQAVGKSLAGTTEVLLPALGITTWMTVFGFLLSSAAGVLIGMALA
FT                   ASRRVERMFAPLLVAVNAVPKIAFGPLLVVAVGWGQKPILTMVFLLCFFPIVLSTATGL
FT                   TTTPADLAELGRSLNASWWQSFRKVRFPAALPQIFVGLKVAMPLAAIGAVIGEFYSDRP
FT                   GLGYQILQYNGVGDTATAWAAIVLVALMSIVLYAVLSLVERLALPWVRATTSAR"
     ttgacacagt cgaccgaggc ccggccggag gcgccgccgc gcccggcggt ccggcgcggg        60
     atggccgtac gcccggcggc ggtcggattg ccggcgctgg gactggtgat cgcggtggcg       120
     gcctggtggc tggtcacctc gggcctgaac ctggtgcacc cggccgcgct gcccccgccg       180
     caggcggtgg ggaagtccct cgccggcacc accgaggtgc tgctgcccgc gctgggcatc       240
     accacctgga tgacagtgtt cggcttcctg ctctcgtcgg cggccggggt gctgatcggg       300
     atggcgctgg ccgcctcccg ccgggtggag cggatgttcg cgccgctgct ggtggcggtg       360
     aacgcggttc cgaagatcgc gttcgggccg ctgctcgtgg tcgcggtggg ctgggggcag       420
     aaacccatcc tgaccatggt gttcctgctc tgcttcttcc cgatcgtgct ctccaccgcc       480
     accggtctga ccaccacccc ggcggacctg gcggagctgg gccggtcgct caacgcctcg       540
     tggtggcagt cgttccgcaa ggtgcgcttc ccggcggcgc tgccgcagat cttcgtcggg       600
     ctcaaggtgg ccatgccgct ggccgcgatc ggcgcggtga tcggggagtt ctactccgac       660
     cgtccgggtc tgggttacca gatcctccag tacaacggcg tcggtgacac cgcgaccgcc       720
     tgggctgcga tcgtgctggt ggcgctgatg agcatcgtgc tctacgccgt cctgagcctg       780
     gtcgagcggc tggccctgcc ctgggtgcgg gccaccacct cagcccgcta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page