(data stored in SCRATCH zone)

EMBL: CP002399.PE567

CP002399.PE567       Location/Qualifiers
FT   CDS_pept        592650..593432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0571"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: stp:Strop_3879 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06121"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU06121.1"
FT                   /translation="MIRLSGVSRTFDGRSGRVEALRGIDLDVAEGEFVAVLGRSGCGKS
FT                   TLLRMIAGLLPVTGGEITVGGTPITKPRRDVAMLFQRPALLPWRSVLDNVLLPVEIFGW
FT                   RRAEHRDRARQLLEMAGLGGFEKRLPHELSGGMQQRVSLCRSLIGSPRVMLMDEPFSAL
FT                   DALTREELSGELQRVHMETKATIVFVTHSIDEAVLLADRVVVLSPRPGRIREVVEVNVP
FT                   RPRTLGRHEHLEDVARISAELHELLMERDAPGVPVGGR"
     atgatccgac tgtccggggt gtcccgcacc ttcgacggcc gttcggggcg ggtggaggcg        60
     ttgcgcggca tcgacctcga cgtcgccgaa ggcgagttcg tcgccgtcct cggccgctcc       120
     ggctgcggca agtccacgct gctgcgcatg atcgccggcc tgctgccggt caccggcggt       180
     gagatcaccg tgggcggtac gccgatcacg aagccccgcc gcgacgtggc gatgctgttc       240
     cagcgtccgg cgctgctgcc ctggcgctcg gtgctggaca acgtgctgct gccggtggag       300
     atcttcggct ggcgccgcgc cgagcaccgc gaccgggccc gccagttgct ggagatggcc       360
     gggctgggcg gcttcgagaa gcgcctcccg cacgagctgt ccggcggcat gcagcagcgc       420
     gtgtcgctgt gccggtcgct gatcggctcg ccccgggtga tgctcatgga cgagccgttc       480
     tccgcgctcg acgcgctcac ccgtgaggaa ctctccggcg aactccagcg ggtgcacatg       540
     gagacgaagg cgacgatcgt cttcgtcacc cactcgatcg acgaggcggt gctgctcgcc       600
     gaccgggtag tcgtgctcag cccgcgcccc ggccgcatcc gcgaggtggt cgaggtgaac       660
     gttccccggc cgcgcacgct gggccgccac gaacacctgg aagacgtcgc gcggatcagc       720
     gccgagctgc acgaactgct gatggagcgg gacgcccccg gcgtacccgt gggaggccgg       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page